KEGG   Arabidopsis thaliana (thale cress): AT2G43050Help
Entry
AT2G43050         CDS       T00041                                 

Gene name
ATPMEPCRD
Definition
(RefSeq) Plant invertase/pectin methylesterase inhibitor superfamily
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase PMEI Pectate_lyase_3 PDEase_I_N
Motif
Other DBs
NCBI-GeneID: 818907
NCBI-ProteinID: NP_181833
MIPS: AT2G43050.1
TAIR: AT2G43050
Araport: AT2G43050
UniProt: Q9SKX2 A0A178VVR7
Position
2
AA seq 518 aa AA seqDB search
MASSSSISNHKIPNTLMFLVIVNFLYLIQTNSAVSISSNSNSHFSRFSRHRSSPSSKTKQ
GFLATVQESMNHALLARSLAFNLTLSHRTVQTHTFDPIHDCLELLDDTLDMLSRIHADND
EEDVHTWLSAALTNQDTCEQSLQEKSESYKHGLAMDFVARNLTGLLTSSLDLFVSVKSKH
RKLLSKQEYFPTFVPSSEQRRLLEAPVEELNVDAVVAPDGSGTHKTIGEALLSTSLASSG
GRTKIYLKAGTYHENINIPTKQKNVMLVGDGKGKTVIVGSRSNRGGWTTYKTATVAAMGE
GFIARDMTFVNNAGPKSEQAVALRVGADKSVVHRCSVEGYQDSLYTHSKRQFYRETDITG
TVDFIFGNSAVVFQSCNIAARKPLPGQRNFVTAQGRSNPGQNTGIAIQNCRITAESMTYL
GRPWKEYSRTVVMQSFIGGSIHPSGWSPWSGGFGLKSLFYGEYGNSGPGSSVSGRVKWSG
CHPSLTVTEAEKFTVASFIDGNIWLPSTGVSFDPGLVN
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatcatcatcaatatcaaatcacaagattccaaacacactaatgtttttggtg
atcgtaaactttttgtacctaattcaaactaattcagctgtcagtatcagttccaattcc
aactcccacttctcaagattctcgagacatcgaagctcaccatcatcaaaaaccaaacaa
gggtttcttgcaacggtccaagagagtatgaaccatgctctcttggctcgttctcttgct
ttcaacctcactctttctcatcgaaccgtacaaacccacacgttcgatcccatccacgac
tgcctcgagctgctcgacgacacacttgacatgttatctcgcatccatgcggataatgat
gaagaagatgtccatacatggctaagcgcagcactcacgaaccaagacacttgtgagcag
agccttcaagaaaaatccgagtcatacaaacacggacttgcgatggatttcgtcgcaaga
aacctaaccggtttgttgactagctcgcttgacttgttcgtatccgtcaagtcaaaacac
cggaaactcttatcgaaacaagagtattttccgacgttcgttccttcgtcggagcaacgg
aggcttctagaagctccggtggaggagctgaatgttgatgcggtggtggctcctgacgga
agtgggacacacaaaaccataggagaagccttgttgtctacgtcattagcgagtagtggg
ggcaggaccaaaatatacctaaaagccgggacatatcatgagaacatcaacattccgacg
aagcagaagaacgttatgttagttggtgacgggaagggtaaaacagtcattgtaggtagc
agaagtaacagaggcggctggactacttacaaaactgcaaccgtcgccgctatgggggaa
gggttcatagcgcgggacatgacattcgtgaacaacgccggacccaaatcggagcaagcg
gtggcgctccgtgtcggagcagataaatccgtcgtgcatcgatgctcagtggaaggatac
caagattcactctacacacactccaaacgacaattctatagagagacggatatcaccggc
accgtcgatttcatattcggaaactccgccgtcgtatttcaatcctgcaacatcgccgca
cggaaacctttaccgggtcagagaaacttcgtgacggcgcaaggacggagcaatccgggt
caaaacaccggaatcgcgattcaaaactgcaggatcacggcggaatcgatgacttatctt
ggtcggccgtggaaggagtattcgaggacggtggtgatgcaatcatttatcggcgggtcg
attcatccgtcgggttggtctccttggtcgggtggtttcggtctcaaatctctgttttac
ggagaatatgggaattcgggtcctggatcatcggtttcgggtcgggttaaatggagtggg
tgtcatccgtctttgacggtgacggaagcggaaaaattcactgtggcgagttttattgac
gggaatatatggttgccgtcaacgggcgttagtttcgacccaggacttgtgaattga

DBGET integrated database retrieval system