KEGG   Arabidopsis thaliana (thale cress): AT2G43330
Entry
AT2G43330         CDS       T00041                                 

Symbol
INT1
Name
(RefSeq) inositol transporter 1
  KO
K08150  MFS transporter, SP family, solute carrier family 2 (myo-inositol transporter), member 13
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT2G43330 (INT1)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   AT2G43330 (INT1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    AT2G43330 (INT1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 Gly-zipper_Omp CarS-like
Other DBs
NCBI-GeneID: 818934
NCBI-ProteinID: NP_850393
TAIR: AT2G43330
UniProt: Q8VZR6
Position
2:join(18001135..18001282,18001502..18001572,18001657..18001992,18002794..18003087,18003174..18003854)
AA seq 509 aa
MTLTIPNAPGSSGYLDMFPERRMSYFGNSYILGLTVTAGIGGLLFGYDTGVISGALLYIK
DDFEVVKQSSFLQETIVSMALVGAMIGAAAGGWINDYYGRKKATLFADVVFAAGAIVMAA
APDPYVLISGRLLVGLGVGVASVTAPVYIAEASPSEVRGGLVSTNVLMITGGQFLSYLVN
SAFTQVPGTWRWMLGVSGVPAVIQFILMLFMPESPRWLFMKNRKAEAIQVLARTYDISRL
EDEIDHLSAAEEEEKQRKRTVGYLDVFRSKELRLAFLAGAGLQAFQQFTGINTVMYYSPT
IVQMAGFHSNQLALFLSLIVAAMNAAGTVVGIYFIDHCGRKKLALSSLFGVIISLLILSV
SFFKQSETSSDGGLYGWLAVLGLALYIVFFAPGMGPVPWTVNSEIYPQQYRGICGGMSAT
VNWISNLIVAQTFLTIAEAAGTGMTFLILAGIAVLAVIFVIVFVPETQGLTFSEVEQIWK
ERAYGNISGWGSSSDSNNMEGLLEQGSQS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgacattgacgatcccaaacgcacctgggagctccgggtacttggatatgttcccagag
agaaggatgtcgtattttgggaattcttacattctgggtttgactgtcactgccggaatc
ggtggccttctgttcggttatgatacaggtgtaatttccggtgcccttttgtacattaag
gatgatttcgaagttgttaagcagagcagtttcttacaggaaactattgtaagtatggct
ttagttggtgccatgattggtgctgcagctggaggttggatcaatgactactacggtcgt
aaaaaggcgactctttttgcagatgttgtctttgcagctggagctatcgttatggctgct
gctcctgatccgtatgttttgatatcgggtcgtctcttggtcggtttaggagttggtgtt
gcttctgtgactgctccggtttatatagcggaagcatctccatcggaagttagaggtgga
cttgtgagcaccaacgtattgatgatcactggtggacagtttctttcatatctcgttaat
tctgctttcacacaggttccaggaacatggagatggatgcttggtgtttcaggcgttccc
gctgtgattcagttcatcctcatgcttttcatgccagaatcccctcgatggcttttcatg
aaaaatcgtaaagcggaagccatccaagtgctcgccagaacctatgacatctcgcggtta
gaagacgagattgatcatctttcagcggctgaagaggaagaaaaacaaaggaagcgcact
gttggctacttggatgttttcagatccaaagaattgagacttgcatttcttgccggagca
ggacttcaggcgtttcagcagttcactggtatcaatacagttatgtactacagccctacg
atagtccaaatggctggatttcactcaaaccagctcgctttgttcctgtctctcattgtt
gctgccatgaatgctgctggaacagtcgtggggatttacttcatcgatcattgtggaagg
aaaaagctagctctctcaagtttatttggcgtcattatatcactcttaatcctctcagtc
tcgtttttcaaacaatctgagacatcatctgatggagggctctatggttggctcgctgtg
cttggcttagctctatacattgttttctttgcaccgggaatgggaccagtcccatggacg
gtgaactcagagatataccctcaacaataccgaggcatatgcggaggcatgtcagctaca
gttaactggatcagcaatttgattgtggcacaaacattcttgacaatcgcggaagctgct
ggaacaggaatgactttcttgattttggcgggaattgcggttcttgctgtaatctttgtg
attgtgtttgtccctgagactcaagggctaacgttttcggaagttgaacagatttggaaa
gaaagagcttatggaaatatcagtggctggggcagtagcagtgatagcaacaacatggaa
gggttactcgagcagggatctcaatcttaa

DBGET integrated database retrieval system