KEGG   Arabidopsis thaliana (thale cress): AT2G44950Help
Entry
AT2G44950         CDS       T00041                                 

Gene name
HUB1
Definition
(RefSeq) histone mono-ubiquitination 1
  KO
K10696  E3 ubiquitin-protein ligase BRE1 [EC:2.3.2.27]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ath04121]
    AT2G44950 (HUB1)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     AT2G44950 (HUB1)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   BRE1 proteins
    AT2G44950 (HUB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_3 zf-C3HC4 zf-RING_5 zf-C3HC4_2 Prok-RING_4 zf-RING_2 zf-RING_6 zf-rbx1 zf-RING_UBOX Tropomyosin_1 Rad50_zn_hook zf-C3HC4_5 zf-ANAPC11
Motif
Other DBs
NCBI-GeneID: 819104
NCBI-ProteinID: NP_182022
MIPS: AT2G44950.1
TAIR: AT2G44950
Araport: AT2G44950
UniProt: Q8RXD6 A0A178VUC4
Position
2
AA seq 878 aa AA seqDB search
MASTGEPDRKRRHFSSISPSEAAAAVKKQPFFWPSSEDKLDTAVLQFQNLKLSQKLEAQQ
VECSILEDKLSQIKEKQLPYNSSLKTVHKSWEKLTASVESCSVRVSDSSSGAHRFVNKED
GSSPAVKNDFINRLLETGATESSSSNICSNQMEENGVNTSSQMTQTLYNLVAATEDLRCL
KDELYPTVLRTNLGKDLCGQLALSELESEIKSFRGDLDDVLVKFKSLSRELQSHRDADAK
VRVDLKRIRGELEDEVVELQQCNGDLSALRAERDATAGAFFPVLSLGNKLATSDRERDKQ
RDLQDMETVLKELTVLASGRLQQLKNLHEERTKMLGKMSNLQNKSKSVRCISSSQACLSL
KDQLEKSKEAVFQYMALLEKLQVEKDSIVWKEREINIKNELGDVSRKTSAVTDSRMASLD
SEIQKQLDEKMRIKTRLGNISRERGRKEIFADMKALISSFPEEMSSMRSQLNNYKETAGG
IHSLRADVQSLSGVLCRKTKEYEALQLRSADYASQLGDLNATVCDLKNSHEELKLFLDMY
KRESTDARDIAEAKEQEYRAWAHVQSLKSSLDEQNLELRVKAANEAEAVSQQMLAAAEAE
IADLRQKMDDCKRDVAKHSDILKSKHEEHGTYLSEIQTIGSAYEDIVPQNQQLLLQVTER
DDYNIKLFLEGITSRQMQDTLLIDKYIMDKDIQQGSAYASFLSKKSSRIEDQLRFCTDQF
QKLAEDKYQKSVSLENLQKKRADIGNGLEQARSRLEESHSKVEQSRLDYGALELELEIER
FNRRRIEEEMEIAKKKVSRLRSLIEGSSAIQKLRQELSEFKEILKCKACNDRPKEVVITK
CYHLFCNPCVQKLTGTRQKKCPTCSASFGPNDIKPIYI
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcacaggcgagcctgaccgtaaaaggcgtcactttagctccatatcaccttct
gaagctgcagccgccgtaaagaaacagcctttcttttggccctcctccgaggacaagctt
gatactgcagttcttcagttccaaaatcttaagctatcacaaaagctagaggctcagcag
gttgagtgttctattcttgaggataaactctctcagatcaaggaaaaacaattaccatac
aactccagtttgaagactgtccataagtcttgggaaaagcttacagcttcagtggaatca
tgctctgttcgtgtgagtgattcaagcagcggagctcataggtttgtaaacaaggaggat
gggtcttctccagccgtgaaaaacgatttcatcaaccggctacttgaaactggtgctact
gagagctcctcatccaatatctgctcgaatcagatggaagaaaatggagtgaatacgtca
agccagatgacgcaaaccttgtataatctagtagccgcgacagaggatttgaggtgtctg
aaggatgaattatatcccacagttctcagaaccaatcttggtaaagatttgtgcggtcag
ctagctctgagtgagttggaatcagaaattaaaagtttcagaggggatctagatgatgta
cttgtgaagttcaaatcactttctagagaattgcagagtcatcgcgatgctgatgctaaa
gttagagtagacctcaaacgaataagaggggagctagaggatgaggttgtggagcttcag
cagtgtaatggtgacttgtcagcattgagagcagaaagggatgcaacagctggggcgttt
ttcccagtgttgagtcttggaaataagcttgctaccagtgatcgggagagggataaacaa
agggatctgcaagacatggaaacagttctgaaagagttaacggtcctggcttcaggcagg
ctacaacagctaaaaaatcttcatgaggagaggacaaagatgcttggaaaaatgagtaat
ttacagaacaagtcaaagtctgtgaggtgcatctcatcttctcaagcctgcctttctttg
aaagaccagctagaaaaatccaaagaagcagttttccagtatatggctttacttgagaaa
ctgcaggttgaaaaagatagtatagtctggaaggaaagggagataaatataaaaaatgaa
ctaggtgatgtttctcgaaagacgtctgctgttactgattctagaatggcttctttggat
tcggagatacagaaacaactggatgaaaaaatgcgaatcaagactaggctgggaaatata
tcaagagagcgaggtagaaaagaaatctttgcagatatgaaggcattaatttcttcgttc
cccgaggaaatgagttccatgcgtagtcaattaaacaattataaagagactgctggaggt
attcattctctgcgggctgatgtccagtccctctctggggttctatgtaggaagacaaaa
gagtatgaagcattgcaattgagatcagctgattatgcttctcagttaggtgacctgaat
gctacggtttgtgatttgaagaacagtcatgaggagttaaagttgtttctggacatgtat
aaacgtgagtccactgatgcgagggacatagctgaagccaaggaacaggagtacagggct
tgggctcatgttcagagtttgaaatcatcccttgatgagcaaaatctggagttgcgcgtt
aaggcagcaaatgaagctgaagccgtttcccaacaaatgttggctgctgcggaagcagag
attgctgatttaaggcagaaaatggatgattgtaaaagggatgtcgccaagcattctgat
atcttgaaatctaaacatgaagaacatggaacatatctttctgaaatacagacaattgga
agtgcctatgaggacattgtaccgcaaaaccaacagcttttgcttcaagttacagagagg
gatgactataacatcaagcttttcttggaaggcataacttctaggcagatgcaagatact
ctgcttatcgataaatacatcatggataaggatatacagcaaggcagtgcatatgccagt
ttcctatccaagaaatcatcaagaattgaagatcagttgaggttctgcacagatcagttt
cagaaactagcggaagataaatatcaaaagtctgtttctcttgaaaatctgcaaaagaaa
cgtgcagacatcgggaatggcttggaacaagctaggtcaaggctggaggagtcccattct
aaagttgagcaaagtcggctggattatggggcattagaactggaactggagattgaaagg
ttcaataggagaaggatagaggaggaaatggaaatagccaaaaagaaagtttctcgtctt
cggtctctcatagaaggatcatcggccattcaaaagctccgacaagaactcagtgaattt
aaagaaattctgaagtgtaaggcctgcaacgatcgcccaaaagaggtggtgattacgaag
tgctaccatttgttctgcaacccatgtgtgcaaaagctcacaggaactcgacaaaagaag
tgtccaacatgctcagcaagttttggaccaaatgatattaaacctatctacatatga

DBGET integrated database retrieval system