KEGG   Arabidopsis thaliana (thale cress): AT2G47490
Entry
AT2G47490         CDS       T00041                                 

Gene name
NDT1
Definition
(RefSeq) NAD+ transporter 1
  KO
K15115  solute carrier family 25 (mitochondrial folate transporter), member 32
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT2G47490 (NDT1)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   AT2G47490 (NDT1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 819362
NCBI-ProteinID: NP_566102
MIPS: AT2G47490.1
TAIR: AT2G47490
UniProt: O22261 A0A5S9X7U8
Position
2
AA seq 312 aa
MSANSHPPNSKNVLCNAAAGAAAGVVAATFVCPLDVIKTRFQVHGLPKLGDANIKGSLIV
GSLEQIFKREGMRGLYRGLSPTVMALLSNWAIYFTMYDQLKSFLCSNDHKLSVGANVLAA
SGAGAATTIATNPLWVVKTRLQTQGMRVGIVPYKSTFSALRRIAYEEGIRGLYSGLVPAL
AGISHVAIQFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRAR
LQEQGHHSEKRYSGVRDCIKKVFEKDGFPGFYRGCATNLLRTTPAAVITFTSFEMVHRFL
VTHIPSEQSSIL
NT seq 939 nt   +upstreamnt  +downstreamnt
atgtccgctaattctcatcctcctaattccaaaaacgtcctctgtaatgcagccgccggt
gccgccgccggggttgttgcggctacgtttgtgtgtcctcttgatgttataaaaacgagg
tttcaggttcatgggctgcctaagctcggtgatgcaaacatcaaaggtagtctaattgtt
ggcagtcttgagcagatcttcaagagagaagggatgcgtggcttataccgcggtctttcc
cctactgtcatggctcttctctccaattgggccatttattttacaatgtatgaccagctc
aagagctttctttgttcaaatgatcacaaactcagcgttggagctaacgtattggctgct
tcgggagctggagctgcaactaccattgccacaaatcctctttgggtcgtcaagactaga
cttcagacacaaggaatgagagtgggtatagtgccatacaaaagcacattttctgcttta
aggagaatagcttatgaggagggaattcgcggattgtacagtggtcttgtccctgcacta
gctggtatcagtcatgttgccattcagtttcccacatatgagatgatcaaagtgtacttg
gccaagaaaggtgataaatcagtcgataacctcaatgctcgtgatgtagcagttgcctct
tcgattgcaaagatatttgcatccacattaacttacccgcacgaggtagtacgagctagg
cttcaagagcaagggcaccacagtgagaaacgttactcaggagtaagagattgcatcaag
aaagtgtttgagaaagatgggttccctggtttttacagaggctgcgccacgaatctactg
agaacaactcctgcagcagttataactttcactagcttcgaaatggtgcatcgtttcctc
gtcactcatataccttctgagcaaagctctatactttaa

DBGET integrated database retrieval system