KEGG   Arabidopsis thaliana (thale cress): AT2G47600
Entry
AT2G47600         CDS       T00041                                 

Symbol
MHX
Name
(RefSeq) magnesium/proton exchanger
  KO
K03452  magnesium/proton exchanger
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT2G47600 (MHX)
Transporters [BR:ath02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   AT2G47600 (MHX)
SSDB
Motif
Pfam: Na_Ca_ex
Other DBs
NCBI-GeneID: 819373
NCBI-ProteinID: NP_566105
TAIR: AT2G47600
UniProt: O22252 A0A5S9X7T9
Position
2:complement(19524117..19527580)
AA seq 539 aa
MASILNQTQELQESSKVLGHLRCENFFLFPGENTLSDGLRGVLYFLGLAYCFIGLSAITA
RFFKSMENVVKHSRKVVTIDPITKAEVITYKKVWNFTIADISLLAFGTSFPQISLATIDA
IRNMGERYAGGLGPGTLVGSAAFDLFPIHAVCVVVPKAGELKKISDLGVWLVELVWSFWA
YIWLYIILEVWSPNVITLVEALLTVLQYGLLLVHAYAQDKRWPYLSLPMSRGDRPEEWVP
EEIDTSKDDNDNDVHDVYSDAAQDAVESGSRNIVDIFSIHSANNDTGITYHTVADTPPDS
ATKKGKAKNSTVFDIWKHQFVDAITLETSESKKVDSIYLRIAKSFWHLLLAPWKLLFAFV
PPCNIAHGWIAFICSLLFISGVAFVVTRFTDLISCVTGINPYVIAFTALASGTSWPDLVA
SKIAAERQLTADSAIANITCSNSVNIYVGIGVPWLINTVYNYFAYREPLYIENAKGLSFS
LLIFFATSVGCIVVLVLRRLIIGAELGGPRLWAWLTSAYFMMLWVVFVVLSSLKVSGVI
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggcctcaattcttaatcaaacccaggagttgcaagaatcttctaaggttcttgggcat
ttaagatgtgaaaacttctttctattccccggagaaaacactttgtcagatggtttgagg
ggtgtgttatattttctcggtcttgcctactgctttattgggttgtcagccatcactgca
cggttcttcaagtctatggagaatgtcgtgaaacattcccgtaaagtggttacaattgat
cccattactaaagctgaagtcatcacatacaagaaagtttggaactttactattgcagac
atcagtttgttggcgtttggaactagcttccctcagatttctttggctaccatcgatgca
atacggaatatgggggagcggtatgctggaggtcttggtcctggaacacttgttggctca
gctgcatttgatcttttccccatccacgctgtttgtgtcgttgtgccaaaagctggagaa
ctgaaaaagatatccgacttaggtgtttggctagttgagctcgtatggtctttttgggct
tacatctggctatacataatcctcgaggtgtggtcaccaaacgtaattacacttgtggag
gcattattgacagtactgcaatacggattgcttctagttcatgcgtacgcccaagacaag
cgatggccttacttgtctttaccaatgtcaagaggtgataggccagaggagtgggttcca
gaggagattgatacatccaaagatgacaatgacaatgatgttcatgatgtgtattcggat
gctgctcaagatgctgttgaatcgggaagcagaaacattgttgatatcttctctattcat
tcagctaacaatgatacagggatcacttatcatactgtggcagatactccacccgattct
gcgactaagaagggtaaggcgaagaattctactgtttttgacatttggaaacatcaattc
gtggatgcaataacgttggaaacatcagaatcaaagaaagtggatagcatttatcttcga
atcgcgaaatctttctggcatttactcctcgccccttggaaactgctttttgcatttgtg
cccccctgcaacattgctcacggttggatcgctttcatctgctctctcctcttcatcagt
ggagtagcctttgttgtcacaagatttactgaccttataagctgtgtcactggaataaac
ccatatgtgatagcattcacagcactcgcaagtggaacttcatggccagacttagtagca
agtaaaatcgctgcagagcgacaactaaccgcagattcagctattgcaaacatcacctgc
agtaactcggtgaacatctatgtggggattggagttccgtggctgataaacacagtctac
aactactttgcatacagagagcctttatacatagaaaacgctaaaggattaagcttttcg
cttctgatattctttgcgacatcagtgggatgtatcgtggtgcttgtgttgagaaggttg
attataggagctgagcttggaggtccaaggctatgggcttggcttacttctgcctatttc
atgatgctttgggtcgtcttcgttgttctttcttctttgaaagtttcaggcgtcatatag

DBGET integrated database retrieval system