KEGG   Arabidopsis thaliana (thale cress): AT2G47900
Entry
AT2G47900         CDS       T00041                                 

Gene name
TLP3
Definition
(RefSeq) tubby like protein 3
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: Tub F-box F-box-like DUF3527
Other DBs
NCBI-GeneID: 819402
NCBI-ProteinID: NP_001031558
MIPS: AT2G47900.1
TAIR: AT2G47900
UniProt: Q8VY21 A0A178VW45
Position
2
AA seq 406 aa
MSFKSLIQDMRGELGSISRKGFDVRFGYGRSRSQRVVQDTSVPVDAFKQSCWASMPPELL
RDVLMRIEQSEDTWPSRKNVVSCAGVCRNWREIVKEIVRVPELSSKLTFPISLKQPGPRG
SLVQCYIMRNRSNQTYYLYLGLNQAASNDDGKFLLAAKRFRRPTCTDYIISLNCDDVSRG
SNTYIGKLRSNFLGTKFTVYDAQPTNPGTQVTRTRSSRLLSLKQVSPRIPSGNYPVAHIS
YELNVLGSRGPRRMQCVMDAIPASAVEPGGTAPTQTELVHSNLDSFPSFSFFRSKSIRAE
SLPSGPSSAAQKEGLLVLKNKAPRWHEQLQCWCLNFNGRVTVASVKNFQLVAAPENGPAG
PEHENVILQFGKVGKDVFTMDYQYPISAFQAFTICLSSFDTKIACE
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgtccttcaagagtctcattcaggacatgagaggagagcttgggagtatatccagaaag
ggattcgatgtcagattcgggtatggtagatccaggtctcaacgtgttgttcaggatact
tctgttcctgttgatgctttcaagcagagctgctgggctagtatgcctccggagctcctg
agagatgttcttatgaggattgagcaatccgaagacacttggccgtctaggaaaaatgtt
gtttcttgcgctggtgtctgcaggaactggcgagaaatcgtcaaagagatcgtcagagtt
cctgagctttctagcaaactcacttttcctatctccctcaaacagccgggtcctagagga
tcacttgttcaatgctatattatgagaaaccgcagcaatcaaacctactatctatacctc
gggttaaaccaagcagcttcaaatgatgatggaaagttccttcttgctgccaagaggttt
cggaggccaacttgcactgactacatcatctccttaaactgcgatgatgtctctcgagga
agcaatacctatatcggaaagcttagatctaactttctggggaccaagttcactgtctat
gacgctcagccgacgaatcctggaactcaggttaccagaacccgttcaagcagacttctc
agtttgaaacaagtgagcccgagaattccatctggcaactatcctgtagcacatatctca
tatgagcttaacgtcttgggttccagaggaccgaggaggatgcagtgtgtcatggatgcc
atccctgcatcagctgtagaacctggaggaacagctccaactcagacggaacttgtccat
agcaatcttgatagtttcccctcattctccttcttcaggtcgaaatcaattcgtgcagag
agtctcccttctggtccatcatctgctgctcagaaggaaggactgcttgtcctgaaaaac
aaagcgcccagatggcacgaacagctccagtgctggtgcctcaacttcaatgggagagtc
acagttgcttccgtcaaaaactttcagctggtagctgctcctgagaatggacctgcagga
cctgagcacgaaaacgtgattctccagtttggaaaagtcggaaaagatgtgttcacaatg
gattatcagtaccctatctctgccttccaggccttcaccatttgcctcagcagtttcgac
accaagatagcatgtgaatga

DBGET integrated database retrieval system