KEGG   Arabidopsis thaliana (thale cress): AT3G01360Help
Entry
AT3G01360         CDS       T00041                                 

Definition
(RefSeq) plant viral-response family protein (DUF716)
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF716
Motif
Other DBs
NCBI-GeneID: 821158
NCBI-ProteinID: NP_001030617
MIPS: AT3G01360.1
TAIR: AT3G01360
Araport: AT3G01360
UniProt: Q9SRI3
Position
3
AA seq 319 aa AA seqDB search
MGILSYAVAGGGFAVIGAWESLDSSNLDPNSSSGTADSSSPMAQIRASPPKSVGSSSIPV
ALLSSLFIANSFFSFFSSIGSRDRVGSMIQLQIVAVAVLFLYYAILTYLVNSKNAVFVAL
PSSITTLLLLFGFIEEFLMFYLQKKDVSGIENRYYDLMLVPIAICVFSTVFELKSDSSTH
RFAKLGRGIGLILQGTWFLQMGVSFFTGLITNNCTFHEKSRGNFTIKCKGHGDYHRAKAI
ATLQFNCHLALMVVVATGLFSVIANKNGYLRQDHSKYRPLGAELENLSTFTLDSDEEDEV
REESNVAKEVGLNGNSSHD
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgggtatattaagttacgccgtcgccggcggtggatttgcagtaatcggcgcgtgggag
tcactggactcatcgaacctggatccgaattcatcttctggtactgctgattcatcttcc
cctatggctcagatcagagcttcgccgccaaaatctgttggatcatcttccatccccgta
gctttgctttcgtctctgtttattgcgaactcgtttttctccttcttcagctcaatcgga
tctcgcgatcgggtcgggtcaatgatccagttacagatcgtggcagtggcagtactattc
ctatattacgccattctaacatatctggtcaactccaaaaacgctgtctttgttgcactt
ccgtcttcgattacaactttattgcttctctttggcttcattgaggagttcttaatgttc
tacctgcaaaagaaagatgtttctggaatcgagaatcgttattacgatctcatgctcgtg
cccattgccatctgcgtcttctccacggtttttgagctcaaatccgactctagcacgcat
cggtttgcgaaattaggtcgtgggatcggtctgattctgcaaggaacatggtttctgcaa
atgggtgtatcgttttttaccggtttgatcactaataactgtacgtttcacgagaagagc
agaggcaatttcacgatcaagtgcaaaggacacggtgattatcaccgagcaaaagctata
gctactcttcaatttaactgtcatttggctctaatggtagttgtggctactggtttgttc
tctgtcattgctaacaagaatggttatctccgtcaagatcattctaaatatcgacctctc
ggagctgagttggagaatttaagtactttcacacttgactctgatgaagaagacgaggtt
cgagaagagagcaacgtagctaaagaagttggtctcaatggaaacagctcacatgattaa

DBGET integrated database retrieval system