KEGG   Arabidopsis thaliana (thale cress): AT3G01440
Entry
AT3G01440         CDS       T00041                                 
Symbol
PnsL3
Name
(RefSeq) PsbQ-like 1
  KO
K08901  photosystem II oxygen-evolving enhancer protein 3
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00195  Photosynthesis
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    AT3G01440 (PnsL3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:ath00194]
    AT3G01440 (PnsL3)
Photosynthesis proteins [BR:ath00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other subunits in plants
    AT3G01440 (PnsL3)
SSDB
Motif
Pfam: PsbQ
Other DBs
NCBI-GeneID: 821143
NCBI-ProteinID: NP_566137
TAIR: AT3G01440
UniProt: Q9SGH4 A0A654FDM2
Structure
Position
3:168408..169662
AA seq 220 aa
MAHFIDLNSLTNTLPSLPKLPESRKTGKSSGFACRRTEEFQEPDSVQITRRMTLGFAVSI
GLTGILGENNVSLAQDNGFWIDGPLPIPPIYNNIVNEKTGTRTFIKKGVYVADIGTKGRM
YRVKKNAFDLLAMEDLIGPDTLNYVKKYLRLKSTFLFYDFDNLISAAASEDKQPLTDLAN
RLFDNFEKLEDAAKTKNLAETESCYKDTKFLLQEVMTRMA
NT seq 663 nt   +upstreamnt  +downstreamnt
atggctcacttcatagacctcaacagtctcaccaacactttaccgtctcttccgaaacta
cccgagagtcgtaaaaccgggaaatccagcgggtttgcttgcaggagaactgaagaattt
caagaaccggattcggtacagatcacaagacggatgacattaggatttgctgtctcaata
ggtcttaccggaattctcggcgaaaataatgtttccttggcacaagacaatgggttttgg
attgatggtcctcttccaattcctcctatttacaacaatatcgtgaatgagaagacggga
acgagaacattcataaagaaaggagtgtatgtagcggatatcgggacgaaaggaagaatg
tatagagttaaaaagaatgcttttgatctcttggcaatggaggatttgatcggaccagat
actttaaactatgtgaaaaagtacttgaggcttaaatccacatttttgttttacgatttc
gacaatctcatctctgctgctgcctctgaagacaagcaacctctcactgatttagccaac
agattgttcgacaatttcgaaaagcttgaagatgcagctaagacgaagaacttagcagag
acggaatcgtgttataaagatacaaagtttcttcttcaagaggtaatgaccagaatggca
tga

DBGET integrated database retrieval system