KEGG   Arabidopsis thaliana (thale cress): AT3G03090Help
Entry
AT3G03090         CDS       T00041                                 

Gene name
VGT1
Definition
(RefSeq) vacuolar glucose transporter 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 YrhK
Motif
Other DBs
NCBI-GeneID: 821117
NCBI-ProteinID: NP_186959
MIPS: AT3G03090.1
TAIR: AT3G03090
Araport: AT3G03090
UniProt: Q8L6Z8
Position
3
AA seq 503 aa AA seqDB search
MGFDPENQSISSVGQVVGDSSSGGITAEKEPLLKENHSPENYSVLAAIPPFLFPALGALL
FGYEIGATSCAIMSLKSPTLSGISWYDLSSVDVGIITSGSLYGALIGSIVAFSVADIIGR
RKELILAAFLYLVGAIVTVVAPVFSILIIGRVTYGMGIGLTMHAAPMYIAETAPSQIRGR
MISLKEFSTVLGMVGGYGIGSLWITVISGWRYMYATILPFPVIMGTGMCWLPASPRWLLL
RALQGQGNGENLQQAAIRSLCRLRGSVIADSAAEQVNEILAELSLVGEDKEATFGELFRG
KCLKALTIAGGLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLGLLKLVMTGV
SVIVIDRVGRRPLLLCGVSGMVISLFLLGSYYMFYKNVPAVAVAALLLYVGCYQLSFGPI
GWLMISEIFPLKLRGRGISLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVVSL
FFIYYIVPETKGLTLEEIEAKCL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggggtttgatcccgagaaccaatcgatctcttccgttggacaggttgttggtgattct
tcttcaggtgggattactgctgaaaaggaacctttgttaaaggaaaaccacagcccagag
aactactctgttcttgcagccattcctccgtttctctttccagctcttggagcattgctt
tttggttatgaaattggtgcaacatcttgtgctatcatgtctcttaagtcgcctactcta
agtggaatttcatggtacgacttgtcttcagtggatgttggtataattaccagtggctca
ctgtatggtgccttaattggctccattgttgcatttagtgttgccgacattataggaagg
agaaaggagctgattttggctgcattcttgtatcttgttggagccattgtgactgtagta
gcacctgtcttttccatactgataattggacgagttacgtatggcatggggattggactg
accatgcacgcggctccaatgtacattgcagagactgctccaagtcaaatacgtggacgg
atgatatcactaaaggaattctccactgtccttgggatggttgggggttatggaatcggt
agcctttggattacggttatttctggttggcgttacatgtacgcaacaattctccctttt
ccagttattatgggaactggaatgtgttggctaccagcatctccgaggtggcttttactg
cgcgctctccagggacaaggaaatggggagaatcttcaacaggctgcgattagatctctt
tgtcgccttagagggtctgtcatagctgactcagcagctgaacaagtaaacgaaatattg
gctgaactttcccttgtgggtgaagacaaagaagctacatttggtgaattatttcgaggc
aaatgcttgaaagctctcactatagcaggagggttagtcttgttccaacagataactggg
caaccaagtgtactatattatgcaccatcaatactacagactgccggcttttctgctgca
gctgatgcaactcggatctcaattctgctcggcctattgaagttggttatgacaggagtt
tctgtgatagttatcgacagagttggaaggagacctttacttctttgtggtgttagcgga
atggtgatctcattgttcctcctgggatcctactacatgttttataaaaatgtaccagct
gttgctgtagctgcattgctactgtatgtaggctgttaccagctgtcctttggccctatt
ggttggctgatgatttcagagatatttcccttaaaattaagaggtagaggaatcagtcta
gcagtgcttgtgaattttggcgcaaacgcacttgtgacattcgctttctcaccgctaaag
gagctgttaggagctggaatactgttctgtgcatttggagtgatatgtgtcgtgtctctc
ttcttcatatactacattgtgccagagacaaagggtctcactcttgaagaaattgaagcc
aaatgtctctaa

DBGET integrated database retrieval system