KEGG   Arabidopsis thaliana (thale cress): AT3G03250Help
Entry
AT3G03250         CDS       T00041                                 

Gene name
UGP1
Definition
(RefSeq) UDP-GLUCOSE PYROPHOSPHORYLASE 1
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00040  Pentose and glucuronate interconversions
ath00052  Galactose metabolism
ath00500  Starch and sucrose metabolism
ath00520  Amino sugar and nucleotide sugar metabolism
ath01100  Metabolic pathways
Module
ath_M00361  Nucleotide sugar biosynthesis, eukaryotes
ath_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AT3G03250 (UGP1)
   00052 Galactose metabolism
    AT3G03250 (UGP1)
   00500 Starch and sucrose metabolism
    AT3G03250 (UGP1)
   00520 Amino sugar and nucleotide sugar metabolism
    AT3G03250 (UGP1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AT3G03250 (UGP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 821313
NCBI-ProteinID: NP_186975
MIPS: AT3G03250.1
TAIR: AT3G03250
Araport: AT3G03250
UniProt: Q9M9P3
Structure
PDB: 

Position
3
AA seq 469 aa AA seqDB search
MAATTENLPQLKSAVDGLTEMSESEKSGFISLVSRYLSGEAQHIEWSKIQTPTDEIVVPY
EKMTPVSQDVAETKNLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRDGLTFLDLIVIQIEN
LNNKYGCKVPLVLMNSFNTHDDTHKIVEKYTNSNVDIHTFNQSKYPRVVADEFVPWPSKG
KTDKEGWYPPGHGDVFPALMNSGKLDTFLSQGKEYVFVANSDNLGAIVDLTILKHLIQNK
NEYCMEVTPKTLADVKGGTLISYEGKVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVN
LKAIKKLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDNAIGVNVPRSRFLPVK
ASSDLLLVQSDLYTLVDGFVTRNKARTNPSNPSIELGPEFKKVATFLSRFKSIPSIVELD
SLKVSGDVWFGSSIVLKGKVTVAAKSGVKLEIPDRAVVENKNINGPEDL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaccactgagaatctccctcaactcaaatccgccgtcgatggccttactgag
atgagtgagagtgagaagagcggattcatcagcctggtttcacgttacctgagcggtgag
gcacaacacattgagtggagtaagatccagactcctaccgatgaaatcgttgttccctac
gagaaaatgacccctgtctcccaagatgttgccgagaccaagaatctgttggacaaactt
gttgtgttgaagcttaatggaggtcttggaacaacaatgggatgcactggcccgaagtcc
gttatcgaagttcgtgatggtttgacatttcttgatctgattgttatccagattgagaat
ctcaacaacaagtatggctgcaaggttccgttagttctcatgaactcgtttaatacacat
gatgacacacataagattgtggaaaagtacaccaactcaaatgttgacattcacactttt
aaccagagcaaatatccccgtgttgtggcagatgagtttgtgccatggcccagcaaggga
aagaccgacaaggagggctggtatcctcccggtcatggtgatgtattcccagccctcatg
aacagtggaaagctcgatactttcttatcacagggtaaggaatatgtgtttgttgccaat
tcagacaacttgggtgccatcgttgacttaacaatcctgaagcatttgatccagaacaag
aacgaatactgcatggaggttacacccaaaaccttagctgatgtaaaggggggaactctc
atttcttatgaaggcaaagtccagcttctggagattgctcaggttcctgatgaacatgtc
aatgagttcaaatcaattgagaagttcaagatattcaacacaaacaacctatgggttaac
ttgaaggccatcaaaaagcttgtggaagctgatgcacttaaaatggagatcattccaaac
ccaaaggaagttgatggagtcaaagttcttcaactggaaactgcagccggtgctgcgata
aggttctttgacaacgctatcggtgttaatgtacctcgctcacggttcttgccagtgaag
gcaagttcagacttgctgctcgtccagtctgatctctacaccttagttgatggctttgtc
actcgaaacaaagctagaactaacccctcgaacccgtcaattgaattgggacccgagttc
aagaaggtggctactttcttgagccggtttaagtccattcctagtatagtcgagctcgac
agccttaaggtgtctggtgatgtctggtttggctcttccattgttctcaagggcaaggtg
actgtggcggcaaaatccggtgtgaagcttgaaattccggacagggccgtggtcgagaac
aagaacatcaatggtccagaagacctctga

DBGET integrated database retrieval system