KEGG   Arabidopsis thaliana (thale cress): AT3G03580Help
Entry
AT3G03580         CDS       T00041                                 

Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR PPR_1 DYW_deaminase PPR_3 PPR_long TPR_14 ATP13
Motif
Other DBs
NCBI-GeneID: 821229
NCBI-ProteinID: NP_187008
MIPS: AT3G03580.1
TAIR: AT3G03580
Araport: AT3G03580
UniProt: Q9SS60
Position
3
AA seq 882 aa AA seqDB search
MQTRVSSPFISRALSSSSNLNELRRIHALVISLGLDSSDFFSGKLIDKYSHFREPASSLS
VFRRVSPAKNVYLWNSIIRAFSKNGLFPEALEFYGKLRESKVSPDKYTFPSVIKACAGLF
DAEMGDLVYEQILDMGFESDLFVGNALVDMYSRMGLLTRARQVFDEMPVRDLVSWNSLIS
GYSSHGYYEEALEIYHELKNSWIVPDSFTVSSVLPAFGNLLVVKQGQGLHGFALKSGVNS
VVVVNNGLVAMYLKFRRPTDARRVFDEMDVRDSVSYNTMICGYLKLEMVEESVRMFLENL
DQFKPDLLTVSSVLRACGHLRDLSLAKYIYNYMLKAGFVLESTVRNILIDVYAKCGDMIT
ARDVFNSMECKDTVSWNSIISGYIQSGDLMEAMKLFKMMMIMEEQADHITYLMLISVSTR
LADLKFGKGLHSNGIKSGICIDLSVSNALIDMYAKCGEVGDSLKIFSSMGTGDTVTWNTV
ISACVRFGDFATGLQVTTQMRKSEVVPDMATFLVTLPMCASLAAKRLGKEIHCCLLRFGY
ESELQIGNALIEMYSKCGCLENSSRVFERMSRRDVVTWTGMIYAYGMYGEGEKALETFAD
MEKSGIVPDSVVFIAIIYACSHSGLVDEGLACFEKMKTHYKIDPMIEHYACVVDLLSRSQ
KISKAEEFIQAMPIKPDASIWASVLRACRTSGDMETAERVSRRIIELNPDDPGYSILASN
AYAALRKWDKVSLIRKSLKDKHITKNPGYSWIEVGKNVHVFSSGDDSAPQSEAIYKSLEI
LYSLMAKEGYIPDPREVSQNLEEEEEKRRLICGHSERLAIAFGLLNTEPGTPLQVMKNLR
VCGDCHEVTKLISKIVGREILVRDANRFHLFKDGTCSCKDRW
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgcagactagagtgtcatcacctttcatctctagagctctttcgtcgtcatctaacctc
aatgagcttcgtcgaattcacgcccttgtgatctctcttggtcttgacagctccgacttc
ttctccggtaagcttatcgacaagtactctcactttcgtgaacccgcctcttccctctct
gttttccgacgagtttctccggccaaaaatgtttacctctggaattcaatcatcagagct
ttttctaagaatggtttgttccctgaagccctcgagttttacgggaaactccgggaatcc
aaggtttctcctgataagtacacgtttccttcggttatcaaagcctgcgcgggattgttc
gatgcggagatgggagatttggtttatgaacagatattggatatgggttttgaatcggat
ttatttgtaggtaatgcacttgtggatatgtattcgagaatgggattgttaactagagca
cgacaagtgttcgacgaaatgcctgtgagagatctcgtgtcctggaacagtttgatttct
gggtatagttcccatggttactatgaggaagctttggaaatttatcatgagttgaagaat
tcgtggattgtaccagattccttcacggtttcaagtgttttgcctgcatttgggaatttg
ctggttgtcaaacaaggacagggacttcatggttttgctctgaagtcaggtgttaattcc
gttgtggtggttaacaatggactagttgcaatgtacttgaaatttcgcagaccaacggat
gcaagacgagtttttgatgagatggatgttcgagattctgttagttacaatactatgatc
tgcggatatctcaagttagagatggttgaagaatccgtgaggatgtttttggaaaacttg
gatcagttcaagcctgatctcttaacagttagttctgttctccgtgcctgcggacactta
cgggacttgagcttggcaaagtacatttacaactatatgttgaaagctggatttgttctt
gaatctactgttagaaacattctaattgacgtgtatgcaaagtgtggtgacatgatcacc
gcaagagatgttttcaacagcatggaatgcaaggatactgtttcgtggaactcgataatc
agtggatatatacaaagcggagatcttatggaagccatgaaactcttcaagatgatgatg
atcatggaagagcaggcggatcacatcacttatttgatgcttatatctgtctccacacgt
ctagcagacttgaaatttgggaaagggctacactcaaatgggataaaatctggaatttgt
atcgatctttctgttagtaatgctttgattgatatgtatgcgaagtgcggggaagtagga
gattccttgaagatattcagtagtatgggaactggggatacggtaacatggaacacggtt
atttcagcatgtgttcgttttggggatttcgcaaccggtttgcaggtaactactcaaatg
aggaagagcgaagtggtgcctgatatggctactttcttagttacattgcctatgtgtgct
tcacttgctgcaaaacgactaggcaaggagatccattgttgtctgttgaggtttggatat
gaatcagagttgcaaatagggaatgcactaattgaaatgtactcaaaatgtggttgtttg
gagaattcgtctagagtctttgaacgtatgagtagaagagatgttgtgacatggacagga
atgatctatgcatatggaatgtatggcgaaggtgagaaagctcttgaaacttttgcggat
atggaaaaatccggtattgttcccgatagtgttgtcttcattgccatcatatatgcttgc
agccactctggtttggtagacgaaggcttggcttgctttgagaagatgaaaactcactac
aaaattgacccgatgattgaacattatgcttgtgtggtcgatttgctgtcccggtcacag
aagatttcaaaagccgaagaatttatccaagcaatgccgataaaaccagatgcaagcata
tgggcatctgtgctaagagcttgtcgaacaagtggggacatggagactgctgaaagagta
tctaggaggatcattgaactgaacccggatgatccaggttactcgattctagcatcaaac
gcatatgcagccttgagaaaatgggacaaagtgagtctaatccgcaaatccttgaaagat
aaacacatcacgaagaatcctggatatagctggatcgaagtcggtaaaaacgttcacgtg
ttcagctcaggagatgattcagctcctcagtcagaagccatctacaagtcactggagata
ctttacagtctgatggctaaagaaggctacattcccgatccaagggaagtgtcacagaat
ctagaggaagaagaagagaagagacgtttaatctgtgggcacagcgagagacttgctatt
gcgtttggactgttgaacacagaaccagggactccattgcaggtgatgaagaaccttcgt
gtttgtggtgactgtcatgaagtcacgaagctgatatcgaagattgtgggacgtgagata
ttagtgcgggatgctaatcgattccatctcttcaaagacggcacttgtagctgcaaagat
cggtggtga

DBGET integrated database retrieval system