KEGG   Arabidopsis thaliana (thale cress): AT3G04030Help
Entry
AT3G04030         CDS       T00041                                 

Gene name
MYR2
Definition
(RefSeq) Homeodomain-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_CC_LHEQLE Myb_DNA-binding
Motif
Other DBs
NCBI-GeneID: 819558
NCBI-ProteinID: NP_001118567
MIPS: AT3G04030.1
TAIR: AT3G04030
Araport: AT3G04030
UniProt: Q9SQQ9
Position
3
AA seq 394 aa AA seqDB search
MYYQNQHQGKNILSSSRMHITSERHPFLRGNSPGDSGLILSTDAKPRLKWTPDLHERFIE
AVNQLGGADKATPKTIMKVMGIPGLTLYHLKSHLQKYRLSKNLNGQANNSFNKIGIMTMM
EEKTPDADEIQSENLSIGPQPNKNSPIGEALQMQIEVQRRLHEQLEVQRHLQLRIEAQGK
YLQSVLEKAQETLGRQNLGAAGIEAAKVQLSELVSKVSAEYPNSSFLEPKELQNLCSQQM
QTNYPPDCSLESCLTSSEGTQKNSKMLENNRLGLRTYIGDSTSEQKEIMEEPLFQRMELT
WTEGLRGNPYLSTMVSEAEQRISYSERSPGRLSIGVGLHGHKSQHQQGNNEDHKLETRNR
KGMDSTTELDLNTHVENYCTTRTKQFDLNGFSWN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtattaccaaaaccagcaccaaggaaagaacatcctctcatcttcaagaatgcatata
acttctgaaaggcatccattccttagagggaatagtccaggtgattctggacttatccta
tcaaccgatgcaaagccacgcctaaaatggactccagatcttcatgagagattcattgaa
gcagtcaatcaactcggtggagcagataaagctactcctaagacaatcatgaaagtcatg
gggattccaggccttaccttataccatctcaaaagtcatcttcagaaatacaggctgagc
aagaatctcaacggacaagctaacaacagcttcaacaaaataggtataatgaccatgatg
gaagaaaagactcctgatgcagacgaaattcaaagcgagaatttaagcattggaccacag
ccaaacaagaattcaccaataggtgaagcactgcaaatgcaaatagaggtccaaagaagg
cttcatgagcaacttgaggtacagcgacatttgcagcttaggatagaggctcaagggaag
tacctgcaatcggttttggagaaagcacaagagactcttggaagacagaacctcggtgca
gctgggatcgaagctgccaaagttcaactctcggaactagtatctaaagtatcagcagag
tacccaaactctagtttcctagaaccaaaagaacttcaaaacctatgctcacaacagatg
caaacaaactatccacctgattgctctcttgaaagttgcctgacctcaagcgagggaacg
cagaaaaactcgaaaatgctagagaacaacagattaggactaagaacgtatattggtgat
tcaacatcggagcagaaagagattatggaagaaccattgttccaaagaatggagctcaca
tggacagaaggtctaagagggaatccatatctttcaacaatggtgagtgaagcagaacaa
agaatctcatattcagaaagaagtccaggtagattatcaataggagtaggattgcacgga
cacaaaagccaacatcaacaaggcaacaatgaggatcataagcttgaaacacgaaaccgg
aaaggcatggattcaacaacagagctagatctcaacacacatgttgaaaactattgtaca
acgcgtacgaaacagttcgacttgaatggtttcagctggaactga

DBGET integrated database retrieval system