KEGG   Arabidopsis thaliana (thale cress): AT3G04750Help
Entry
AT3G04750         CDS       T00041                                 

Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR PPR_1 PPR_3 PPR_long
Motif
Other DBs
NCBI-GeneID: 819635
NCBI-ProteinID: NP_187126
MIPS: AT3G04750.1
TAIR: AT3G04750
Araport: AT3G04750
UniProt: Q9SR01 A0A178VL32
Position
3
AA seq 661 aa AA seqDB search
MCFVLLLRRGFRLFGTECGSKTTKWDPVQSLQLNHQSLVLLENCNSRNQFKQVLAQIMRF
NLICDTFPMSRLIFFSAITYPENLDLAKLLFLNFTPNPNVFVYNTMISAVSSSKNECFGL
YSSMIRHRVSPDRQTFLYLMKASSFLSEVKQIHCHIIVSGCLSLGNYLWNSLVKFYMELG
NFGVAEKVFARMPHPDVSSFNVMIVGYAKQGFSLEALKLYFKMVSDGIEPDEYTVLSLLV
CCGHLSDIRLGKGVHGWIERRGPVYSSNLILSNALLDMYFKCKESGLAKRAFDAMKKKDM
RSWNTMVVGFVRLGDMEAAQAVFDQMPKRDLVSWNSLLFGYSKKGCDQRTVRELFYEMTI
VEKVKPDRVTMVSLISGAANNGELSHGRWVHGLVIRLQLKGDAFLSSALIDMYCKCGIIE
RAFMVFKTATEKDVALWTSMITGLAFHGNGQQALQLFGRMQEEGVTPNNVTLLAVLTACS
HSGLVEEGLHVFNHMKDKFGFDPETEHYGSLVDLLCRAGRVEEAKDIVQKKMPMRPSQSM
WGSILSACRGGEDIETAELALTELLKLEPEKEGGYVLLSNIYATVGRWGYSDKTREAMEN
RGVKKTAGYSSVVGVEGLHRFVAAEKQNHPRWTEIKRILQHLYNEMKPKLDCLDLLEIEI
K
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgtgctttgtgttgttgttgcggcgaggatttcgattatttggcacagaatgtgggagc
aagacaaccaaatgggatcctgttcaatcacttcagctgaatcatcaatctcttgtcttg
ctcgagaattgcaattccaggaatcaattcaagcaggttttggcacagatcatgcgtttc
aatctcatctgcgatacgtttcccatgagccgtcttatcttcttctcggcgatcacatac
ccagagaatctcgacttggcgaagcttctatttcttaatttcactcccaacccgaatgtt
tttgtttacaacacaatgatatctgctgtttcgagctcgaaaaatgaatgctttggtctg
tatagttctatgattaggcaccgtgtctctcctgacaggcaaacgtttctctatctcatg
aaagcttcgagttttctgtcggaagtgaagcagatccattgccatatcattgtttctggg
tgtttgtctcttgggaattacctgtggaattctctggttaagttttacatggagttggga
aattttggtgttgcagagaaggtgtttgctagaatgcctcatccagatgtcagctctttt
aacgttatgattgttggttatgctaagcagggttttagtttagaggcacttaaactgtat
tttaagatggttagtgatggtattgaacctgatgagtacactgtgctgagtcttcttgtt
tgttgtggtcatttatcagatattagacttgggaagggagttcatggttggattgagagg
agaggacctgtttattcatctaatttgattctgagcaatgctcttttggacatgtatttc
aaatgcaaagaatctggtcttgctaaaagagcttttgatgcgatgaagaagaaagacatg
cgctcttggaacaccatggttgttgggtttgttaggcttggggacatggaagctgctcag
gctgtttttgatcagatgcccaaaagggatcttgtttcttggaactctcttctttttggt
tattcgaagaagggatgtgaccaaagaaccgtcagagaattgttctatgaaatgacgatc
gtggagaaggtcaagccagaccgcgtcactatggttagtttgataagtggtgcagcaaac
aacggagaactgagccatggaagatgggtgcacggattagtgatccgtctgcaactgaaa
ggtgatgcctttctgagttcggctctgatagatatgtactgcaaatgtggtatcattgag
cgggcttttatggttttcaagacagctaccgagaaagatgtcgcgctatggacatcaatg
ataactgggttggccttccacggaaatggccagcaagctctgcagctattcggaagaatg
caagaagaaggtgtgacgccaaacaatgtcactctgctcgctgtcctgacagcttgcagt
catagcggactcgtggaggaagggctacacgttttcaaccacatgaaggataaattcggc
tttgaccctgaaactgagcattacggaagccttgtggatctgttgtgtagggcagggaga
gtagaggaagcgaaagacatagtgcaaaagaagatgccaatgagaccaagtcagtcaatg
tggggatcaatcttaagtgcttgtcggggaggtgaagacattgaaaccgcagagttggct
ttaactgaattgcttaagttggaacctgaaaaagaaggcggatacgttttgttgtctaat
atatatgcaaccgttggaagatggggatattcagacaagacgagagaagcaatggagaat
cgcggagtaaagaagactgcaggatatagtagtgtagttggagtagagggacttcatagg
tttgtggctgcagagaagcaaaaccatccaagatggacggagataaaaagaatattgcag
catctgtataatgaaatgaagccaaaattggattgtttggacttgttagaaatagagatc
aaatag

DBGET integrated database retrieval system