KEGG   Arabidopsis thaliana (thale cress): AT3G04910Help
Entry
AT3G04910         CDS       T00041                                 

Gene name
WNK1
Definition
(RefSeq) with no lysine (K) kinase 1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT3G04910 (WNK1)
   01009 Protein phosphatases and associated proteins [BR:ath01009]
    AT3G04910 (WNK1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT3G04910 (WNK1)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: Other
  Wnk family
   AT3G04910 (WNK1)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AT3G04910 (WNK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 819651
NCBI-ProteinID: NP_187142
MIPS: AT3G04910.1
TAIR: AT3G04910
Araport: AT3G04910
UniProt: Q9CAV6
Position
3
AA seq 700 aa AA seqDB search
MNNLSYLEPDYSEFVEVDPTGRYGRYNEVLGKGASKTVYRAFDEYEGIEVAWNQVKLYDF
LQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTANRNINFVTELFTSGTLRQYRLRHK
RVNIRAMKHWCRQILRGLHYLHSHDPPVIHRDLKCDNIFVNGNQGEVKIGDLGLAAILRK
SHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFDYPYSECTHPAQIYKKVMS
GKKPDALYKVKDPEVKCFIEKCLATVSLRVSARELLDDPFLRIDDGEFDLRSVDMEDSVG
PLYRQPHHLPDYYNYPSNSSSLNRQYSNGNYPSNSSSLNRQYSNGYNSHHEYQNGWAYNP
AETEETHGIELFESRNNDDQEEEKKSGNVDITIKGKRRDDGGLFLRLRIADKEGRVRNIY
FPFDIETDTALSVATEMVAELDMDDHGVTKIANMIDGEISSLVPSWRPGPEFEECLAAAA
AANAASICNNCVSNRTSMGSVMDFLRTNPGANVIQCCRNGCGETHGRFEEITIRETEVRL
RELWKLQQQQESRELSSIDSGHNHSEEEEEEEVLYEDPENMFSCEAGNEINHISGSGSFS
FMPSKYCDEPSEKTENQVQQELRWLKAKCQIELRDIQDEQLKTRWPESGEEVEISPKDGF
LGSVSGLGREEDTVKEMFGERLVPKCLKRTTSLPVDAIDS
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatctgagttatcttgaaccagattactctgagtttgttgaagttgatcctact
ggaagatatggaagatacaatgaagttcttggtaaaggagcttcaaagactgtttataga
gcatttgatgaatatgaaggcatagaagtagcatggaaccaagttaagctatatgatttc
ctacaaagccctgaggatcttgagaggctttactgtgagattcatcttctcaagactcta
aaacataagaacatcatgaaattctacacttcttgggtcgataccgccaatcgaaatatc
aatttcgtcactgaattgttcacttctggcaccttaagacaatatagactcagacataag
agagtgaacataagagctatgaagcattggtgcagacaaatcttgagaggcttacattat
cttcacagccatgatcctcctgtgatccacagggatctcaaatgtgacaacattttcgtt
aacgggaatcaaggagaggtcaagattggagatcttggccttgctgctattttaagaaag
tcccatgctgctcactgcgtcgggactcctgagttcatggcacctgaagtttacgaagaa
gcatataacgaattggttgatatatactcgttcggtatgtgtattttggagatggttacg
tttgattacccgtacagtgagtgtactcatcctgctcagatctacaagaaagttatgtcg
ggcaagaaaccggatgcattgtacaaggtgaaagaccccgaggttaaatgtttcattgag
aaatgcttggccaccgtatcgcttagagtctctgctcgtgagttactagatgaccctttt
ctccgtatagacgatggtgagtttgatttaagatcagttgatatggaagattcggtcggg
ccactctataggcagccgcaccatcttcctgactactacaattacccgtcgaatagtagc
tctttgaatcgtcagtactcaaatggcaactacccgtcgaatagtagctcattgaatcgt
cagtactcaaatggttataatagtcatcacgagtatcagaatggatgggcgtataatcca
gctgagacagaggagactcacggcatcgagctctttgaatctcgaaacaatgatgatcaa
gaagaagaaaagaaatctggtaatgttgacataaccatcaaagggaagaggagagatgat
ggtggcttgttcttgcgtcttaggatcgctgacaaagaaggacgtgtccgaaacatttac
ttcccatttgacattgagacggacaccgcattgagcgttgcaacagagatggtagcggaa
ctggatatggacgatcatggagtcacaaaaatagccaacatgattgacggtgagatatct
tctcttgtacctagttggagaccgggacctgaattcgaagaatgtcttgcggctgcggcg
gcggcaaatgctgcgagcatttgcaacaactgcgtatcaaaccgcacctcaatgggctcg
gtgatggatttcctgagaaccaatcctggggcaaatgtgatacaatgttgcagaaacggg
tgcggtgagactcatggtcggtttgaagagatcacgatcagagaaaccgaggttcgtctt
agagagctatggaagctgcagcaacagcaagaaagccgcgagctaagctcgatagattca
ggccataaccattccgaagaagaggaggaagaagaggtgctatacgaagaccccgaaaac
atgttttcttgcgaggcaggtaacgagataaaccatatatcgggttctggatcgttctcg
tttatgccatctaaatactgcgatgagccatccgaaaaaaccgaaaatcaggtccaacaa
gagttgagatggcttaaagccaaatgccaaattgagcttagagatattcaggatgaacaa
ctaaaaacccggtggccggaatccggagaagaggtggaaatttctccgaaagacgggttc
ttgggttcggtttccgggttaggaagagaagaagatacggtgaaagagatgtttggagaa
agattggtaccaaagtgtctgaaaagaacaacttcacttcctgttgatgccattgattct
tga

DBGET integrated database retrieval system