KEGG   Arabidopsis thaliana (thale cress): AT3G05150Help
Entry
AT3G05150         CDS       T00041                                 

Definition
(RefSeq) Major facilitator superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 819677
NCBI-ProteinID: NP_001326593
MIPS: AT3G05150.1
TAIR: AT3G05150
Araport: AT3G05150
UniProt: Q0WQ63
Position
3
AA seq 470 aa AA seqDB search
METRKDDMEKRNDKSEPLLLPENGSDVSEEASWMVYLSTIIAVCGSYEFGTCVGYSAPTQ
FGIMEELNLSYSQFSVFGSILNMGAVLGAITSGKISDFIGRKGAMRLSSVISAIGWLIIY
LAKGDVPLDFGRFLTGYGCGTLSFVVPVFIAEISPRKLRGALATLNQLFIVIGLASMFLI
GAVVNWRTLALTGVAPCVVLFFGTWFIPESPRWLEMVGRHSDFEIALQKLRGPQANITRE
AGEIQEYLASLAHLPKATLMDLIDKKNIRFVIVGVGLMFFQQFVGINGVIFYAQQIFVSA
GASPTLGSILYSIEQVVLTALGATLLIDRLGRRPLLMASAVGMLIGCLLIGNSFLLKAHG
LALDIIPALAVSGVLVYIGSFSIGMGAIPWVIMSEIFPINLKGTAGGLVTVVNWLSSWLV
SFTFNFLMIWSPHGTFYVYGGVCVLAIIFIAKLVPETKGRTLEEIQAMMM
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggagacaagaaaagacgacatggagaaaaggaacgacaaatccgagccgttgctgctg
ccggagaatggatccgacgtctcagaagaagcatcatggatggtttatctaagcacgatc
attgccgtttgcggttcctacgagtttggaacatgcgtgggatactccgctccaacacag
tttgggattatggaagagcttaatttatcatattcccagttttcggttttcggatcgata
ttgaatatgggagcagtgctcggcgccattacatcggggaagatttctgatttcatcggt
cggaaaggggccatgcggttgtcttcagtgatctctgccatcggctggctgataatttac
ttggccaagggtgacgtacctttggatttcggaagatttctaacgggttatggttgcggt
accctttcctttgtggtaccggtcttcatcgccgaaattagtccgagaaaattgagagga
gccttagcgacgcttaaccagctctttatcgtaatcggattagcttctatgttcctcata
ggcgccgtcgtaaattggagaactcttgcactaaccggagttgcaccgtgcgtggttcta
ttctttgggacttggttcatccctgaatcacccagatggctggaaatggttggccgccac
agtgattttgaaattgcgttgcaaaaactgaggggtcctcaggccaatatcacaagagaa
gccggggaaattcaggagtacttagcgagtcttgctcacctcccgaaagccacattgatg
gaccttattgacaaaaagaatattcgatttgtgatagttggagttggtttgatgtttttc
caacaattcgttggaattaatggcgttatcttctacgcacaacaaatattcgtatcagca
ggagcatccccaactcttggaagcattctatactcgatcgaacaagtcgttctcacagca
ctaggcgcaacattgctaattgatcggcttggaagaaggccacttcttatggcttcagct
gttgggatgctgattggatgtttgctcatcggaaattcatttcttttgaaggctcatggt
ttagcacttgacatcattccggctctggcagttagtggtgtcttggtctacatcggttcg
ttctctattggaatgggtgcaatcccatgggttataatgtctgagatatttccaataaat
ttgaaaggaactgccggaggacttgtcactgtagtaaattggctaagttcatggcttgtc
tcattcactttcaactttctcatgatttggagccctcatggtacattttatgtgtatggt
ggggtatgtgtattggctattatcttcatagcaaaacttgttcctgaaactaaaggcaga
accttggaagagattcaagcaatgatgatgtaa

DBGET integrated database retrieval system