KEGG   Arabidopsis thaliana (thale cress): AT3G05400Help
Entry
AT3G05400         CDS       T00041                                 

Definition
(RefSeq) Major facilitator superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 819704
NCBI-ProteinID: NP_187191
MIPS: AT3G05400.1
TAIR: AT3G05400
Araport: AT3G05400
UniProt: Q8VZT3
Position
3
AA seq 462 aa AA seqDB search
MEGENNMEKGLLLAKKEDSANTTPLLIFSTFIIVSASFTFGAAIGYTADTMSSIMSDLDL
SLAQFSLFGSLSTFGGMIGAIFSAKAASAFGHKMTLWVADLFCITGWLAISLAKDIIWLD
MGRFLVGIGVGLISYVVPVYIAEITPKHVRGAFTFSNQLLQNCGVAVVYYFGNFLSWRTL
AIIGSIPCWIQVIGLFFIPESPRWLAKKGRDKECEEVLQKLRGRKYDIVPEACEIKISVE
ASKKNSNINIRSLFEKRYAHQLTIGIGLMLLQQLCGTAGISSYGSTLFKLAGFPARIGMM
VLSLIVVPKSLMGLILVDRWGRRPLLMTSALGLCLSCITLAVAFGVKDVPGIGKITPIFC
FIGILSFTMMFAIGMGALPWIIMSEIFPMDIKVLAGSLVTIANWFTGWIANYAFNFMLVW
SPSGTFIISAIICGATIVFTWCLVPETRRLTLEEIQLSFVNV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggaaggagagaataatatggagaaaggattgttattggcaaaaaaggaagacagtgca
aatacaactccacttcttatcttctccaccttcatcattgtctctgcctccttcaccttt
ggcgctgccataggttatactgcagatacaatgtcctccattatgtcagacttggatctt
tctctcgcacaattttcgctgtttggttcgttgtcgacgtttggaggaatgatcggtgca
atattcagcgccaaagctgcaagtgccttcggtcataaaatgacgttgtgggtggctgat
ttattctgcataactggttggcttgcaatttcactagccaaggatattatttggcttgac
atggggcgatttttggtgggaattggagttggtctcattagctacgtggttcctgtatat
attgcagaaataacacccaagcacgtaagaggggcttttacatttagcaatcagcttttg
caaaactgtggagttgcagtcgtatattactttggaaatttcttgtcatggagaacttta
gccataataggtagtattccatgttggatacaagttattggtttgttcttcatacctgag
tctccaagatggctggcgaaaaaaggtcgtgataaagaatgtgaagaagttcttcaaaag
ttaagaggaagaaaatacgatattgtgcctgaagcttgcgaaatcaagatttcagttgaa
gcttcgaagaaaaattcgaatatcaacattcgtagtcttttcgaaaagagatatgctcat
caacttacaatcggcattggtttgatgcttctgcaacagttatgtggaactgcaggaata
agttcttacggaagcactctatttaaacttgccgggtttcctgctcggattgggatgatg
gtgttatctcttatcgtcgtaccaaaatctttaatgggtctaatcctcgtggatcgatgg
ggaagacgcccacttcttatgacttcagcgttggggttgtgtttaagctgtatcacattg
gcagtagcgtttggagttaaagatgtcccgggaattggaaaaattactccaattttctgt
ttcattggaatattgtcgtttacgatgatgttcgcaattggaatgggagcgttaccatgg
attataatgtctgagatatttccaatggatataaaggtattagctgggagtttagtgacc
atagcaaattggttcactggttggatcgccaactatgctttcaattttatgttggtttgg
agcccaagcgggacttttataatatccgctataatctgtggagcaacaattgtattcaca
tggtgcttggtgccggagactcgaagattaacgttagaagaaatccaactgtcgtttgtc
aatgtttag

DBGET integrated database retrieval system