KEGG   Arabidopsis thaliana (thale cress): AT3G05500Help
Entry
AT3G05500         CDS       T00041                                 

Definition
(RefSeq) Rubber elongation factor protein (REF)
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: REF
Motif
Other DBs
NCBI-GeneID: 819715
NCBI-ProteinID: NP_187201
MIPS: AT3G05500.1
TAIR: AT3G05500
Araport: AT3G05500
UniProt: Q9MA63 A0A178VB80
Position
3
AA seq 246 aa AA seqDB search
MATQTDLAQPKLDMTKEEKERLKYLQFVQAAAVEALLRFALIYAKAKDKSGPLKPGVESV
EGAVKTVVGPVYEKYHDVPVEVLKYMDQKVDMSVTELDRRVPPVVKQVSAQAISAAQIAP
IVARALASEVRRAGVVETASGMAKSVYSKYEPAAKELYANYEPKAEQCAVSAWKKLNQLP
LFPRLAQVAVPTAAFCSEKYNDTVVKAAEKGYRVTSYMPLVPTERISKIFAEEKAETEPL
EFHPLD
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggctactcaaacggatctcgctcagcccaagcttgatatgaccaaggaggagaaagag
aggttgaagtatttgcaattcgtgcaagctgctgctgtggaagctctgcttcgctttgct
cttatttacgctaaggcaaaggacaagtctggtcctttgaaacctggtgttgaatctgtt
gaaggagctgtcaagactgtcgttggtcctgtctacgagaaataccacgacgtccctgtt
gaggtccttaaatacatggaccagaaggttgatatgtctgtgactgagcttgaccgtcgt
gtcccaccagtcgtcaagcaagtgtctgcccaagccatctccgctgctcagatagcaccc
attgtggcacgtgcgttggcctctgaggttcgacgtgctggtgttgttgaaaccgcttct
ggaatggctaaatccgtctactccaagtacgagcctgctgctaaggagttgtatgcaaac
tatgagccaaaagcagagcagtgtgccgtttcagcttggaagaagcttaaccagcttcct
ctattcccaaggctggctcaagttgctgtaccaacagctgctttctgctctgagaagtac
aatgatactgtggttaaggctgcagagaaagggtacagagtcacatcgtacatgccattg
gttccaacagagaggatctcaaaaatcttcgctgaggagaaagctgagaccgagcctttg
gagttccatccacttgattga

DBGET integrated database retrieval system