KEGG   Arabidopsis thaliana (thale cress): AT3G06050Help
Entry
AT3G06050         CDS       T00041                                 

Gene name
PRXIIF
Definition
(RefSeq) peroxiredoxin IIF
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Redoxin AhpC-TSA AhpC-TSA_2 Stap_Strp_toxin
Motif
Other DBs
NCBI-GeneID: 819778
NCBI-ProteinID: NP_566268
MIPS: AT3G06050.1
TAIR: AT3G06050
Araport: AT3G06050
UniProt: Q9M7T0 A0A178VBA5
Position
3
AA seq 201 aa AA seqDB search
MAMSILKLRNLSALRSAANSARIGVSSRGFSKLAEGTDITSAAPGVSLQKARSWDEGVSS
KFSTTPLSDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKSHIDKFKAKGIDSVICVSVNDP
FAINGWAEKLGAKDAIEFYGDFDGKFHKSLGLDKDLSAALLGPRSERWSAYVEDGKVKAV
NVEEAPSDFKVTGAEVILGQI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgtcaattctaaagctaagaaatttatcggcactaagatcggcggcaaatagt
gcccggatcggagtttcatcgaggggtttctcaaagctcgcggaaggcactgacataacc
tcggcggcgcctggcgtttctctccagaaagctcgcagctgggacgaaggtgtttcctcc
aaattctccaccacgccattgtcagatatcttcaaggggaagaaagtcgtcatctttggt
cttcctggggcttacacgggagtttgttcacagcagcatgtgcctagctacaagagccac
attgataagtttaaagccaaaggcattgattctgtcatctgtgtctctgttaatgatccc
tttgctatcaatggttgggcagagaagcttggtgccaaagatgcaattgagttttatgga
gattttgatgggaaatttcacaaaagcttggggctagacaaggatctctctgctgcattg
ctcgggccacggtctgagagatggtcggcttatgtagaagacgggaaggttaaggcggtg
aatgtggaagaagcaccgtctgacttcaaggttacaggggcagaagtcatcttaggacag
atctaa

DBGET integrated database retrieval system