KEGG   Arabidopsis thaliana (thale cress): AT3G06060
Entry
AT3G06060         CDS       T00041                                 

Gene name
TSC10A
Definition
(RefSeq) NAD(P)-binding Rossmann-fold superfamily protein
  KO
K04708  3-dehydrosphinganine reductase [EC:1.1.1.102]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00600  Sphingolipid metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    AT3G06060 (TSC10A)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.102  3-dehydrosphinganine reductase
     AT3G06060 (TSC10A)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase GDP_Man_Dehyd NAD_binding_10 RmlD_sub_bind Glyco_tran_WecB DFP Sacchrp_dh_NADP ApbA
Other DBs
NCBI-GeneID: 819779
NCBI-ProteinID: NP_187257
MIPS: AT3G06060.1
TAIR: AT3G06060
UniProt: Q0WRJ2
Position
3
AA seq 326 aa
MAAISPLFLLFLIPIIPLSLLAILALIVRPRPIKIPIKSRHAFITGGSSGIGLALAHRAA
SEGARVSILARSGSKLEEAKKSIQLATGVEVATFSADVRDYDAVSKAIDESGPIDVLIVN
QGVFTAKELVKHSPEDVKFTIDVNLVGSFNVIKAALPAMKARKDRGPASISLVSSQAGQV
GVYGYAAYSASKFGLQGLAQALQQEVISDDIHVTLIFPPDTNTPGFEEEQKSRPEVTAII
AASSGSMETEEVAKKAMDGIKAGNFTVSCNFEGFLLSLATTGMSPQRSFWLAFLEVITAG
PIRLIALFFQWDWYKAIEKWSKTKTK
NT seq 981 nt   +upstreamnt  +downstreamnt
atggcggccatttctcctctcttccttctcttcctcattcccattatcccactatcgctt
ctcgctatcttagccctaattgtacgtcctcgtcccattaagatccctatcaagtcccgt
cacgccttcatcaccggtggatctagcggcatcggtcttgctctcgcccaccgcgccgct
tccgagggcgctcgtgtctcaatcctcgcccgatccggatcaaagctcgaggaggctaag
aaatcgatccagctcgccactggtgtcgaagtcgccacattctctgcagacgttcgcgat
tacgatgcagtctcgaaggcgatagatgaatcgggaccgatcgatgtgttgattgttaac
caaggtgtgtttacggcgaaggagctggtgaaacatagtcctgaagatgtcaaattcacg
attgacgtaaatcttgttgggagcttcaatgtgattaaagccgctttgcctgccatgaaa
gcaaggaaagatcgtggacctgcttccatcagtctcgtctcctctcaagctggtcaggtt
ggtgtctatggttatgctgcatattcagcaagcaagtttggtcttcagggtttagcgcaa
gcattgcaacaggaagttatatctgatgatattcatgtcactcttatttttcctcctgac
actaatacacccggctttgaagaagaacagaagagcagacctgaagtcactgccataata
gctgcatcctctggttcaatggaaacagaagaagtagcaaaaaaggctatggatggcata
aaagcaggaaacttcaccgtctcatgcaactttgagggattcttactgtctctcgcgaca
accggcatgtcccctcaaagatcattttggcttgcttttcttgaagttataaccgcaggg
cctataagattaatcgctctcttctttcaatgggattggtataaagccattgaaaaatgg
agcaaaaccaaaaccaaatga

DBGET integrated database retrieval system