KEGG   Arabidopsis thaliana (thale cress): AT3G06100
Entry
AT3G06100         CDS       T00041                                 

Symbol
NIP7;1
Name
(RefSeq) NOD26-like intrinsic protein 7;1
  KO
K09874  aquaporin NIP
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT3G06100 (NIP7;1)
Transporters [BR:ath02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    AT3G06100 (NIP7;1)
SSDB
Motif
Pfam: MIP PsbJ
Other DBs
NCBI-GeneID: 819783
NCBI-ProteinID: NP_566271
TAIR: AT3G06100
UniProt: Q8LAI1 A0A178V7E3
Position
3:complement(1841168..1843196)
AA seq 275 aa
MNGEARSRVVDQEAGSTPSTLRDEDHPSRQRLFGCLPYDIDLNPLRIVMAELVGTFILMF
SVCGVISSTQLSGGHVGLLEYAVTAGLSVVVVVYSIGHISGAHLNPSITIAFAVFGGFPW
SQVPLYITAQTLGATAATLVGVSVYGVNADIMATKPALSCVSAFFVELIATSIVVFLASA
LHCGPHQNLGNLTGFVIGTVISLGVLITGPISGGSMNPARSLGPAVVAWDFEDLWIYMTA
PVIGAIIGVLTYRSISLKTRPCPSPVSPSVSSLLR
NT seq 828 nt   +upstreamnt  +downstreamnt
atgaatggtgaggcacggtcaagagtagtcgaccaagaagctggctcaactccatctact
ttgagagatgaagatcatccctcgagacaaaggcttttcggatgtctcccttatgatata
gatctcaatcccctacgcattgtaatggcggaattggtggggacattcattctaatgttc
agtgtgtgtggggtcataagcagtacccaattatccggcggccacgtgggattgctagag
tacgccgtcaccgctggattatctgtggtggtcgtagtttactccatcggacacatctct
ggcgcccatcttaacccttccatcaccattgctttcgctgtctttggcggattcccgtgg
tctcaggttccgttgtatataacggcgcaaacattgggggcaacggcggcaacattagtt
ggggtgtcagtgtacggagtaaacgctgacattatggcaacaaaacctgctttaagctgc
gtttctgcatttttcgttgaactcatagctacgagcatcgtcgtgtttctcgcctccgcg
ttgcattgtggtcctcatcaaaatttgggtaatttgacggggttcgtgattggaacagtc
atttcccttggagtgcttattaccggaccgatttcaggaggatcgatgaacccagctcga
tcacttggaccggcggtggtggcatgggattttgaagacttatggatttacatgacagct
ccggtgatcggagccataatcggagttttgacatacagatcaattagcctaaaaaccagg
ccttgcccttctccagtttccccttccgtttcttcacttttacgttaa

DBGET integrated database retrieval system