KEGG   Arabidopsis thaliana (thale cress): AT3G07080
Entry
AT3G07080         CDS       T00041                                 

Name
(RefSeq) EamA-like transporter family
  KO
K15289  solute carrier family 35, member F5
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT3G07080
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   AT3G07080
SSDB
Motif
Pfam: EamA SLC35F PUNUT TPT UAA
Other DBs
NCBI-GeneID: 819894
NCBI-ProteinID: NP_187364
TAIR: AT3G07080
UniProt: A0A384KCI9 Q9SFT8
Position
3:2241002..2243124
AA seq 438 aa
MSTKLWRWVLGLIYLFAVATIWIAASFVVQSVVEAGVSPFLITFICNSLFVVYLPLFEIG
RYLEDAYGSLLFWRSKRSHLMELVESEKAVLLGKDVSGVKSDATESSGLVVREQEISEGG
NGIESGLENIELEIDASVNVSDGASGVSNKGLDEKGRWTRMRVAKVSLVICPFWFLAQLT
FNVSLKYTTVTSNTILSSASSLFTFLVSLIFLGEKFTWLKLFSVLLCMSGTIIVSMGDSE
SKSNAVAKNPLLGDILSLVSAALYAVYITLIRKKLPDDDERNGRVSMAQFLGFLGLFNFF
IFLPPALILNFTKRERFNALTLKQFGLVVGKGLLDNVLSDYLWAKAVLLTTTTVATAGLT
IQVPLAAIVDSLSGNKPSFTDYIGAAAVMVGFAGINIPSEMFCKSKETAIELEPGTSFTD
PPPIVPDSIRVDSSLTVV
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgtcaacaaagttatggagatgggtgttagggctgatatacctatttgccgttgccacg
atttggattgcggctagttttgtagtccagtctgtggtggaagctggtgtttctccgttc
ttgatcactttcatttgtaattcattgttcgttgtttatcttcccctttttgagattggt
cgatatctggaagatgcatatgggagtttattgttctggagaagcaaaaggtcgcattta
atggaactggtcgaatcagagaaggctgttttgcttggaaaagatgtttctggtgtgaaa
tcagatgctactgagagttcagggcttgttgtgagagagcaagagattagtgagggtggt
aatgggattgaatctggattggaaaatatagagcttgagattgatgctagtgtcaatgtt
agtgatggagctagtggagtttctaataaaggattagatgagaagggtcgttggacaagg
atgcgagttgctaaagttagccttgtgatttgtccgttttggtttttggcgcagcttaca
tttaatgtctctctcaagtacacaacagttacgtcaaataccatattaagcagtgcatca
agccttttcacctttcttgtttcactaatattcttgggtgagaagttcacatggttgaaa
ctcttcagcgttcttctttgtatgtctgggactataattgtaagtatgggtgactcagag
tccaagtcaaatgcagtagctaagaaccctcttttgggagatattctttcgctggtctca
gcggcgctgtatgctgtctacatcactcttatacgcaaaaagcttccggatgatgatgaa
agaaacggccgggtcagtatggctcagttcctcgggtttcttggtctcttcaatttcttc
attttccttcctcctgctctaatactcaacttcacaaagcgagaacgcttcaacgcactt
accttgaaacaatttggcctagttgttggcaaaggtttgttagataatgtgcttagtgac
tatctgtgggcaaaggcagtactattgacaacaaccactgtagctacagctgggctaact
attcaggtcccattggcagccattgtagacagcttatcagggaacaaaccaagcttcacc
gactacattggtgctgcagctgttatggttggctttgcagggattaatattccctcagag
atgttttgcaaatccaaagagactgctattgagttagaacctgggacttcgttcacagat
cctcctccgattgtgccagatagcataagagtagattcttcactgactgtagtataa

DBGET integrated database retrieval system