KEGG   Arabidopsis thaliana (thale cress): AT3G07140Help
Entry
AT3G07140         CDS       T00041                                 

Definition
(RefSeq) GPI transamidase component Gpi16 subunit family protein
  KO
K05292  GPI-anchor transamidase subunit T
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    AT3G07140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16 Lactococcin_972
Motif
Other DBs
NCBI-GeneID: 819900
NCBI-ProteinID: NP_566299
MIPS: AT3G07140.1
TAIR: AT3G07140
Araport: AT3G07140
UniProt: Q949U5 A0A384K908
Position
3
AA seq 644 aa AA seqDB search
MASLLRSLILLLIVQSFLVAIAFGSKEVEEFSEALLLKPLPDRKVLAHFHFENRAPPSNS
HGRHHHLFPKAISQLVQKFRVKEMELSFTQGRWNHEHWGGFDPLSSMNAKPVGVELWAVF
DVPQSQVDTSWKNLTHALSGLFCASINFLESSTSYAAPTWGFGPNSDKLRYGSLPREAVC
TENLTPWLKLLPCRDKDGISALMNRPSVYRGFYHSQRLHLSTVESGQEGLGSGIVLEQTL
TVVLQPETTSVESNMQPSWSLSSLFGRQVVGRCVLAKSSNVYLQLEGLLGYESKNVDTEI
EAHQLWKNAEFELSLKPERVIRESCSFLFIFDIDKSSDSEPFDLGLTWKRPSKWSCQQAP
LHSSRFLMGSGNERGAIAILLKATESQEKLSGRDLTNGQCTIKANIFQIFPWYIKVYYHT
LQIFVDQQQKTDSEVLKKINVSPSTDKVSSGMMEMMLELPCEVKSVAISIEYDKGFLHID
EYPPDANQGFDIPSALISFPDHHASLDFQEELSNSPLLSSLKEKSLVRSYTEVLLVPLTT
PDFSMPYNVITITCTIFALYFGSLLNVLRRRIGEEERFLKSQAGKKTGGLKQLLSRITAK
IRGRPIEAPSSSEAESSVLSSKLILKIILVAGAAAAWQYFSTDE
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggctagtcttcttcgatccttaatccttttgctaatcgtgcaatcatttttggttgcg
atcgctttcgggtcgaaagaagttgaagaattcagcgaggcattgctcttgaagccttta
cctgatcgaaaagttttagctcacttccacttcgagaaccgagctcctccgtcaaactcc
catggccgccatcaccatctcttcccgaaagctatttctcagttggttcagaagtttcgg
gtcaaggagatggagttatcttttactcagggtcgatggaaccatgaacattggggagga
tttgaccctctatcaagtatgaatgcgaagcctgttggtgtggagctgtgggctgtgttt
gatgttcctcagtctcaggttgatacttcttggaagaacttaactcatgcactgtcaggg
cttttctgtgcttccatcaattttctagaatcttccacttcatatgctgctcctacatgg
ggatttggacccaattctgacaagctgaggtatggttcactgccacgtgaagctgtttgt
actgagaacttgaccccatggctaaagttacttccttgtagagataaggatggtatttct
gcgttaatgaataggccatctgtttacagagggttttatcattctcagagattgcattta
tccacggttgaatctggtcaagagggattgggttctggtatagtgctggagcagacgctt
actgttgttcttcagcctgagactacttctgttgaatcaaatatgcagccaagttggtcc
ctcagctccctctttgggagacaagttgttgggagatgtgttcttgcaaagtcaagtaat
gtgtatcttcaattggaaggtcttcttggttacgaatcaaaaaacgtggatacagaaata
gaagcacaccaactatggaagaatgcagagtttgaattgtctcttaagccagagagggtt
attcgagaaagctgcagctttctttttatttttgatattgacaaatcaagtgacagcgag
ccatttgatcttggccttacttggaagcgtccctcaaagtggtcatgtcaacaagctcca
ttacactcgagtcggtttttgatgggaagcgggaacgaaagaggtgcaatagccatcttg
ttaaaagcgacagaatctcaggagaagttatcaggcagagatctcactaatggccaatgt
acaataaaagcaaatatcttccagattttcccatggtatattaaggtttattatcatact
ctacaaatctttgtggatcaacaacagaagacagacagtgaggtcttaaagaagatcaat
gtctcaccatctacggataaggtgtcatctggcatgatggagatgatgttggaactacca
tgtgaagtgaaatctgtagccatatcaattgaatatgataagggttttctgcatatagat
gaatatcctcctgatgctaatcaaggattcgacattccatcggctttgataagcttcccc
gatcatcatgctagtttagatttccaagaagagctcagcaactcgcccttattatcaagt
ttaaaggaaaaatccttagtacgctcttacacagaagtattgctcgtacctttgacaacc
cctgattttagcatgccttacaacgtaatcacgatcacatgcaccatcttcgcattgtat
tttggatcattgctaaatgttctacgtagacgaattggtgaagaagaaaggtttctcaaa
agccaagcaggaaagaaaacaggtgggcttaagcagttattatcgagaatcacagccaag
attagagggagaccaattgaagcaccatcatcatcagaagctgaatcttcggtcttgtct
agtaaacttatcttaaaaatcatattagttgcaggagctgctgcagcgtggcaatatttt
tccacggacgagtag

DBGET integrated database retrieval system