KEGG   Arabidopsis thaliana (thale cress): AT3G07880Help
Entry
AT3G07880         CDS       T00041                                 

Gene name
SCN1
Definition
(RefSeq) Immunoglobulin E-set superfamily protein
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT3G07880 (SCN1)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT3G07880 (SCN1)
  Exosomal proteins of other body fluids (saliva and urine)
   AT3G07880 (SCN1)
  Exosomal proteins of colorectal cancer cells
   AT3G07880 (SCN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rho_GDI Phosducin
Motif
Other DBs
NCBI-GeneID: 819979
NCBI-ProteinID: NP_187445
MIPS: AT3G07880.1
TAIR: AT3G07880
Araport: AT3G07880
UniProt: Q9SFC6 Q541X0 A0A384KJQ8
Position
3
AA seq 240 aa AA seqDB search
MSLVSGARDMGFDDNNNNKNNKDGDDENSSSRTRADDDALSRQMSESSLCATEEEEDDDS
KLQLGPQYTIKEHLEKDKDDESLRKWKEQLLGSVDVTNIGETLDPEVRIDSLAIISPGRP
DIVLLVPENGNPKGMWFTLKEGSKYNLKFTFHVNNNIVSGLRYTNTVWKTGVKVDRAKEM
LGTFSPQLEPYNHVMPEETTPSGMFARGSYSARTKFLDDDNKCYLEINYSFDIRKEWPAL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtctttggtatctggagccagggacatggggttcgacgacaacaacaacaacaagaac
aacaaggatggagatgatgagaactcctcctccagaacaagagccgacgacgatgctctt
agtcgacagatgagcgaatcttctctttgtgctaccgaggaggaagaagacgacgattcc
aaattgcaattgggtcctcagtacactatcaaagaacatctcgagaaggacaaggatgat
gagagtctgaggaaatggaaggaacagcttctcggaagtgttgatgtcaccaacattgga
gagactcttgatccggaagtgaggattgatagcctcgccatcatatctcctggaagaccc
gacattgttctcttggttcctgagaatggaaatccaaagggcatgtggtttactttgaaa
gaagggagcaagtacaacttgaaattcacttttcatgttaacaacaacattgtctctggt
cttaggtacaccaatacagtttggaagaccggtgtcaaagtggacagagctaaggaaatg
cttggaacctttagtcctcagttggagccatacaaccacgtgatgccagaagagaccact
ccttctggcatgtttgctcgaggatcatattctgcaagaactaagtttcttgatgatgat
aataagtgctacttggagatcaactacagctttgacatccgtaaagaatggcctgcgctt
tga

DBGET integrated database retrieval system