KEGG   Arabidopsis thaliana (thale cress): AT3G08580
Entry
AT3G08580         CDS       T00041                                 

Gene name
AAC1
Definition
(RefSeq) ADP/ATP carrier 1
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT3G08580 (AAC1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT3G08580 (AAC1)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AT3G08580 (AAC1)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   AT3G08580 (AAC1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 820005
NCBI-ProteinID: NP_187470
MIPS: AT3G08580.1
TAIR: AT3G08580
UniProt: P31167 A0A384KYV2 Q0WVD8
Position
3
AA seq 381 aa
MVDQVQHPTIAQKAAGQFMRSSVSKDVQVGYQRPSMYQRHATYGNYSNAAFQFPPTSRML
ATTASPVFVQTPGEKGFTNFALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRL
SEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDG
YWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAKAAKKGGGGRQFDGLVDVYRKTL
KTDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVLLTGDLQDSFFASFALGWVITNGA
GLASYPIDTVRRRMMMTSGEAVKYKSSLDAFKQILKNEGAKSLFKGAGANILRAVAGAGV
LSGYDKLQLIVFGKKYGSGGA
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggttgatcaagttcagcaccccactattgcgcagaaagctgccgggcagttcatgcgt
tcaagtgtttccaaggacgttcaagtgggttaccagaggccttctatgtatcaaagacat
gcaacctacggaaactactccaatgctgcatttcaatttcctccgacatcccggatgttg
gcaacaactgcttctcccgtgtttgtccaaaccccaggagagaaggggttcactaacttt
gcccttgactttctgatgggtggtgtttctgctgccgtctccaagactgctgctgctcct
attgaacgtgttaagcttttgatccagaaccaggatgagatgattaaagctggcaggctt
tctgaaccctacaagggtattggtgactgtttcggcaggacgattaaggatgaaggtttt
ggttctctatggagaggaaacactgccaatgttatccgttatttccccactcaggccttg
aactttgccttcaaagattacttcaaaagacttttcaactttaagaaggacagagatggt
tactggaagtggtttgctggtaacttggcatctggaggagcagctggtgcctcttccctt
ctgtttgtgtactcccttgactatgcccgtacccgtctagctaatgatgccaaggctgca
aagaaaggaggtggtggaagacagtttgatggtcttgttgatgtctacagaaagacactt
aagactgatggtattgctggtctgtaccgtggattcaacatctcatgtgttggtatcatt
gtctaccgtggtctgtactttggactctatgactctgtgaagcctgttctcctcactggt
gacttacaggacagtttcttcgctagtttcgctcttggatgggttattaccaatggtgcg
ggtcttgcatcctaccccattgacactgtccgcagaagaatgatgatgacgtctggtgaa
gctgtcaagtacaagagttctttggacgccttcaagcagatcctcaagaatgaaggagcc
aagtcactcttcaagggagctggtgccaacattctgcgtgctgttgcaggtgctggtgtg
ctttccggttacgacaaattgcagctgattgtcttcggtaagaagtacggatcaggaggt
gcctaa

DBGET integrated database retrieval system