KEGG   Arabidopsis thaliana (thale cress): AT3G08720Help
Entry
AT3G08720         CDS       T00041                                 

Gene name
S6K2
Definition
(RefSeq) serine/threonine protein kinase 2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT3G08720 (S6K2)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   AT3G08720 (S6K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_C Kdo APH RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 820019
NCBI-ProteinID: NP_001327295
MIPS: AT3G08720.1
TAIR: AT3G08720
Araport: AT3G08720
UniProt: Q39030
Position
3
AA seq 471 aa AA seqDB search
MVSSQCSVANKNQTGKPFQKHLSLSISPPKSVLGDNLELQFSDVFGPMPEANSEEACDVA
YDEPAVVYSRSHSLVGPSLVVSHSLKMNKLTLRETEDSVDLVECVEGESIKENDEFSGND
DTDSEKSPEEVSGVVGIEDFEVLKVVGQGAFGKVYQVRKKDTSEIYAMKVMRKDKIVEKN
HAEYMKAERDILTKIDHPFIVQLKYSFQTKYRLYLVLDFINGGHLFFQLYHQGLFREDLA
RVYTAEIVSAVSHLHEKGIMHRDLKPENILMDVDGHVMLTDFGLAKEFEENTRSNSMCGT
TEYMAPEIVRGKGHDKAADWWSVGILLYEMLTGKPPFLGSKGKIQQKIVKDKIKLPQFLS
NEAHALLKGLLQKEPERRLGSGPSGAEEIKKHKWFKAINWKKLEAREVQPSFKPAVSGRQ
CIANFDKCWTDMSVLDSPASSPNSDAKANPFTNFTYVRPPHSFLHRTTSNL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggtttcttctcagtgttctgttgcaaacaaaaaccagactgggaagccgtttcagaaa
catctatctttatccatcagccctccaaaatctgtcttgggtgataaccttgagcttcaa
ttctctgatgtctttggaccaatgcctgaagctaactctgaagaggcctgtgatgttgct
tacgacgagcctgctgttgtctacagtcgatcccactcattggttggcccgtctttggtt
gttagccattctttgaagatgaacaagctcactttacgagaaactgaggactcagttgac
ttggtggagtgtgttgaaggtgaatcgataaaagagaacgatgaattctctggtaatgat
gacactgacagtgagaaatctccagaggaggtctcaggtgtagtaggcattgaggacttt
gaggtattgaaggttgtgggacaaggtgcatttggaaaagtgtaccaggtgaggaaaaaa
gacacgtctgagatatacgcgatgaaggtcatgagaaaagataaaattgttgagaagaat
catgctgaatacatgaaagccgagcgcgatattctaaccaaaatcgatcatcctttcatt
gtgcaacttaaatactcttttcagaccaaatacagattgtatcttgttcttgactttata
aacggaggtcatcttttcttccagctctatcaccaagggcttttcagggaggacttggct
cgtgtgtacactgcagaaatcgtctctgcagtttcccatctccatgagaaaggcataatg
catagagatcttaaacctgaaaacatactcatggacgtagatggccatgtgatgttaact
gattttggtttagcaaaagaatttgaagaaaacacaagatcaaactccatgtgtgggact
acggagtatatggcccctgagattgttcgtggaaaaggacatgataaggctgccgactgg
tggagtgtaggaatccttctgtatgagatgctcactggaaagccgccgtttctcgggagc
aaaggaaagatacagcagaaaatcgttaaggacaagatcaagcttccacagtttctgtct
aatgaagctcatgccttgctgaaagggctgctgcaaaaagagccagaaaggagactggga
agtggaccgagcggagcagaggagataaaaaaacacaaatggttcaaggcgataaactgg
aagaagctggaggctagagaagtacaaccaagtttcaagccggcggtttcgggaagacaa
tgcatagctaattttgacaagtgttggactgacatgtctgttttggattctccagcaagt
agtcccaactctgatgctaaggcgaacccttttacaaacttcacatacgtcaggcctcct
cattcattccttcatcggaccacatccaacttgtag

DBGET integrated database retrieval system