KEGG   Arabidopsis thaliana (thale cress): AT3G09740Help
Entry
AT3G09740         CDS       T00041                                 

Gene name
SYP71
Definition
(RefSeq) syntaxin of plants 71
  KO
K08506  syntaxin of plants SYP7
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    AT3G09740 (SYP71)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G09740 (SYP71)
Membrane trafficking [BR:ath04131]
 SNARE
  SNAP-25[C] (Qc)
   Syp7
    AT3G09740 (SYP71)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNARE DUF848 DUF5089 Ran-binding APG17 Uso1_p115_C
Motif
Other DBs
NCBI-GeneID: 820132
NCBI-ProteinID: NP_566354
MIPS: AT3G09740.1
TAIR: AT3G09740
Araport: AT3G09740
UniProt: Q9SF29 A0A384KWM4 Q2HIU8
Position
3
AA seq 266 aa AA seqDB search
MTVIDILTRVDSICKKYDKYDVDKQREANISGDDAFARLYGAFETQIETALEKAELVTKE
KNRAAAVAMNAEIRRTKARLSEEVPKLQRLAVKRVKGLTTEELAARNDLVLALPARIEAI
PDGTAGGPKSTSAWTPSSTTSRPDIKFDSDGRFDDDYFQESNESSQFRQEYEMRKIKQEQ
GLDMISEGLDALKNMASDMNEELDRQVPLMDEIDTKVDRATSDLKNTNVRLKDTVNQLRS
SRNFCIDIVLLCIVLGIAAYLYNVLK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgatcgatattctgactagagttgactcgatctgtaagaagtacgacaagtac
gatgtcgacaaacagcgggaggccaatatctccggcgatgatgcctttgctcgtctctat
ggagctttcgaaacccaaatcgagaccgctctcgagaaagctgaacttgttacgaaggag
aaaaacagggctgctgctgttgcaatgaatgctgagatccgccggaccaaggcacgattg
tcagaggaagttcccaagttgcaaagacttgctgtcaagcgggttaagggccttacaacc
gaagagcttgctgcgagaaatgatttggtgctcgctcttccagccaggattgaagccata
cctgatgggacagcaggtggccctaaaagcactagtgcttggactccctcctcaacaaca
tctcgtcctgatatcaaatttgattcagatgggcgttttgacgatgattactttcaagaa
tcaaatgaatctagccaattcaggcaggagtatgagatgcggaaaataaaacaggaacaa
ggtcttgacatgatctccgaagggttagatgctttgaagaacatggcttctgatatgaac
gaggaactggatagacaagttccactgatggatgaaatcgacacaaaggtggacagagca
acctccgatcttaagaacaccaatgttagacttaaagataccgtgaaccagctgagatct
agccggaacttctgtatcgatattgttttgttgtgtattgttctgggtatcgctgcatac
ttatacaatgtactgaagtaa

DBGET integrated database retrieval system