KEGG   Arabidopsis thaliana (thale cress): AT3G10370Help
Entry
AT3G10370         CDS       T00041                                 

Gene name
SDP6
Definition
(RefSeq) FAD-dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00564  Glycerophospholipid metabolism
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AT3G10370 (SDP6)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AT3G10370 (SDP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 GIDA Pyr_redox HI0933_like AAA_30 Pyr_redox_3 3HCDH_N DUF4179
Motif
Other DBs
NCBI-GeneID: 820199
NCBI-ProteinID: NP_187648
MIPS: AT3G10370.1
TAIR: AT3G10370
Araport: AT3G10370
UniProt: Q9SS48 A0A178VGW1
Position
3
AA seq 629 aa AA seqDB search
MSLASIRRLAAGAAVIAAASGGAVYLSPSVASSDKGGGPILDSLRRRLGDPTASVPSRSA
QESALIAATASDPLDVLVIGGGATGSGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLIH
GGVRYLEKAVFNLDYGQLKLVFHALEERKQLIENAPHLCHALPCMTPCFDWFEVIYFWMG
LKMYDLVAGPRLLHLSRYYSAKESIELFPTLARKGKDKNLRGTVVYYDGQMNDSRLNVGL
ACTAALAGAAVLNHAEVVSLITDDATKRIIGARIRNNLTGQEFNSYAKVVVNAAGPFCDS
IRKMIDEDTKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTD
SNTSITSLPEPHEDEIQFILDAISDYLNIKVRRTDVLSAWSGIRPLAMDPTAKSTESISR
DHVVFEENPGLVTITGGKWTTYRSMAEDAVDAAIKSGQLKPTNECVTQKLQLLGSYGWEP
SSFTTLAQQYVRMKKTYGGKVVPGAMDTAAAKHLSHAYGSMADRVATIAQEEGLGKRLAH
GHPFLEAEVAYCARHEYCESAVDFIARRCRIAFLDTDAAARALQRVVEILASEHKWDKSR
QKQELQKAKEFLETFKSSKNAQFNDGKHN
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcgcttccattcgccgtttagctgccggagctgccgtaattgccgctgcatcc
ggtggcgctgtctacctgtctccgtcggttgcctccagcgacaaaggaggtggtccgatt
ctagattcgttgaggcgtaggcttggtgatcccaccgcttctgtaccgtctcgatctgct
caagagtctgctctgattgcagccaccgcttctgatccgctcgatgttctcgtcattggc
ggtggagccaccggttctggagttgctcttgacgctgttacacgtggcctccgtgttggt
ttggtggagcgcgaggatttctcctctgggacttcttcgcgatctacaaagctgattcat
ggaggggttcgttacttggagaaagctgttttcaatcttgattatggacagctgaagctt
gtatttcacgctcttgaggagcgtaaacagctcattgagaatgcgccacatctctgtcat
gctctgccctgtatgacaccttgttttgattggttcgaagttatctacttctggatgggg
ttgaagatgtatgacttggttgctggaccacggttattgcatctgtccagatattactct
gcaaaagagtctattgagctcttccccactcttgcaaggaaagggaaagacaagaatttg
aggggtactgttgtgtattatgacgggcaaatgaacgattcacgtctgaatgtgggtttg
gcatgtactgccgcgttagctggtgcggcagttctcaaccatgccgaggttgtctcgctt
attactgatgatgctactaagagaataattggtgcccgaattcgtaacaatctcacaggc
caagaatttaacagctatgcaaaagtagttgttaatgcggcaggaccgttctgtgattcc
attaggaaaatgattgatgaagatacaaaaccaatgatttgtccaagcagcggtgtacac
atcgtgctgcctgattactattctcctgaaggcatggggttgatagtccctaaaactaag
gatggccgcgttgtgtttatgttaccgtggttgggaagaacagtagcaggcactacagac
tctaatacttcaatcacttcacttccagaacctcatgaagatgagattcaatttatactg
gacgcaatcagcgactatcttaacattaaggttcgacgtactgatgttctttcggcttgg
agtgggatccgtccattggccatggatccaacagccaagagcacagagagtatctccaga
gaccacgttgtcttcgaggaaaatcctggtctggttacaatcacgggtggaaagtggaca
acttatcgaagcatggcggaagatgcagttgatgcagcaatcaaatcgggacaacttaag
ccaaccaatgaatgtgtaacgcagaaactacagcttctgggttcttatggatgggaacca
tcttccttcacaactcttgcacagcaatacgtgcgcatgaagaaaacatacggtggtaaa
gtggttcctggagcaatggacacagctgctgcaaagcatttgtctcatgcctatggttca
atggctgaccgagttgccaccatagctcaggaggagggtttggggaaacggttggcgcat
gggcatccgtttttggaagctgaggttgcttactgtgcaaggcacgagtactgcgaatca
gcggttgatttcatagcaaggagatgtagaatcgcgttcttggacactgatgcagcggct
cgggcgttgcagcgtgtggtggagattctagcaagtgaacacaaatgggacaagtcgagg
cagaagcaagagttgcaaaaggctaaagagtttcttgaaactttcaagtcgtccaaaaac
gcacagtttaacgatggcaagcacaactaa

DBGET integrated database retrieval system