KEGG   Arabidopsis thaliana (thale cress): AT3G12250
Entry
AT3G12250         CDS       T00041                                 

Gene name
TGA6
Definition
(RefSeq) TGACG motif-binding factor 6
  KO
K14431  transcription factor TGA
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    AT3G12250 (TGA6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT3G12250 (TGA6)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   Plant G-box-binding factors
    AT3G12250 (TGA6)
SSDB
Motif
Pfam: DOG1 bZIP_1 bZIP_2 bZIP_Maf CPSF_A IclR Tape_meas_lam_C MotA_ExbB
Other DBs
NCBI-GeneID: 820405
NCBI-ProteinID: NP_001326019
MIPS: AT3G12250.1
TAIR: AT3G12250
UniProt: Q39140 A0A384KPR6 A1A6J5
Position
3
AA seq 330 aa
MADTSSRTDVSTDGDTDHRDLGSDRGHMHAAASDSSDRSKDKLDQKTLRRLAQNREAARK
SRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHSR
WLEEKNRQMNELRSALNAHAGDTELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWK
TPAERCFLWLGGFRSSELLKLLANQLEPMTERQVMGINSLQQTSQQAEDALSQGMESLQQ
SLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMLRVLTT
RQSARALLAIHDYSSRLRALSSLWLARPRE
NT seq 993 nt   +upstreamnt  +downstreamnt
atggctgataccagttcaaggactgatgtctcaactgatggtgacacagatcatagagat
ctggggtctgatagagggcatatgcatgctgctgcctctgattccagtgatcgatcaaag
gataagttggatcaaaagacccttcgtaggcttgctcaaaatcgtgaggcagcaagaaaa
agcagattgaggaagaaggcgtatgttcagcagctggagaatagtcgattaaagctgact
caacttgagcaggagctgcaaagagcaagacagcagggagttttcatctcaagttcagga
gaccaagctcattctactggtggcaatggggctttggcatttgatgcagaacactcacga
tggcttgaagaaaagaacaggcaaatgaacgagctgagatctgccctgaatgctcatgca
ggtgatactgagctccggataattgtggatggagtgatggctcactatgaggagcttttc
aggattaagagcaatgcagctaagaatgatgtcttccacttgttatctggaatgtggaaa
acaccagctgagcgatgtttcttgtggcttggcgggttccgctcatccgaacttctcaag
cttcttgcgaatcagctagagcccatgacagaacgacaggtaatgggcatcaatagcttg
cagcagacgtcgcagcaggcagaagatgctttatctcaagggatggagagtttacagcaa
tccctagctgatactttatccagtggaactcttggttccagttcatcggataatgtcgcg
agctacatgggtcagatggccatggcaatggggcagttaggcaccctcgaaggattcata
cgccaggctgataacttgaggctgcaaacactacaacagatgcttcgagtattaacaaca
cgtcagtcagctcgtgctcttcttgctatacacgattattcatctcgattacgtgctctt
agttccttgtggcttgcccggccaagagagtga

DBGET integrated database retrieval system