KEGG   Arabidopsis thaliana (thale cress): AT3G13410
Entry
AT3G13410         CDS       T00041                                 

Name
(RefSeq) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: ATP-synt_S1
Other DBs
NCBI-GeneID: 820541
NCBI-ProteinID: NP_566456
TAIR: AT3G13410
UniProt: Q93WB8 A0A654F6S4
Position
3:complement(4361635..4364316)
AA seq 321 aa
MKKIQIGAVALLVFLSVASLFEIGLASPNTVPAFLWSPHLQSANGELDEAVNYQVMSAKD
LVGSVFTQGGWSNFLCSEKKLEQPVDVALVFIGRELLSSDVSSKRNSDPALVNTLNNLFT
ASNFSLAFPYIAAPEEERMENLLLSGLKEACPNNVGVSNIVFSDSCFVEDGTIQKLSDLQ
SFKDHLLARRETRKEGETDLVVLCSEGSESNSQAGQSHSERESFLELVSSVEQSGSKYTA
LYVSDPYWYTSYKTLQRFLAETAKGNSTPEIATGCDELCKFKSSLLEGILVGIVFLLILI
SGLCCMAGIDTPTRFETPQDS
NT seq 966 nt   +upstreamnt  +downstreamnt
atgaagaagattcaaattggtgcggtggcgctattggtgtttctatctgtggcctctctc
tttgaaatcggattggcttctccgaacacagttcctgctttcctctggtctccgcatctc
cagtctgctaatggtgaattggatgaggctgtaaattatcaggtcatgtctgcaaaggat
ctagttggttctgttttcactcaaggaggttggtcaaactttctgtgctcagagaagaag
cttgagcaacctgttgatgttgcacttgtgttcataggcagagagttactgtcttctgat
gtttcttcaaaaaggaactcagatcctgcccttgttaacacattgaataatctatttaca
gcttccaacttctcattggcattcccatatattgctgctccagaggaagaaaggatggag
aatttgttactttcagggcttaaagaagcttgtcccaacaatgtaggagtcagcaatatc
gtgttctcagattcgtgctttgttgaggatggaacaattcagaaactttcagacttgcag
tctttcaaagatcatttgcttgctagaagagaaacaaggaaagaaggagaaactgacttg
gttgtgctctgttccgagggttctgaatcgaatagtcaagctggacagtcacattcagag
cgtgaaagcttcttggaacttgttagttctgtagaacaatccggcagtaaatatacagct
ctttatgtttctgatccttattggtacacatcttacaaaactctccaaaggtttctagct
gaaactgctaaaggaaacagtactcctgaaattgctactggctgtgatgaactctgcaaa
tttaagtcatcacttttggagggcatactagtgggaatcgtttttcttctcatcttgatc
agtggactttgctgtatggcgggtatcgatacaccgactagattcgagactcctcaagat
tcttaa

DBGET integrated database retrieval system