KEGG   Arabidopsis thaliana (thale cress): AT3G13772Help
Entry
AT3G13772         CDS       T00041                                 

Gene name
TMN7
Definition
(RefSeq) transmembrane nine 7
  KO
K17086  transmembrane 9 superfamily member 2/4
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT3G13772 (TMN7)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT3G13772 (TMN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EMP70 MFS_1
Motif
Other DBs
NCBI-GeneID: 820587
NCBI-ProteinID: NP_187991
MIPS: AT3G13772.1
TAIR: AT3G13772
Araport: AT3G13772
UniProt: Q9LIC2 A0A178V8P8
Position
3
AA seq 641 aa AA seqDB search
MKKTKGSSFRFYATLLLSFLSFSLSRAFYLPGVAPRDFQKGDPLYVKVNKLSSTKTQLPY
DYYYLNYCKPPKILNNAENLGEVLRGDRIENSVYTFQMLEDQPCKVGCRVKLNADSTKNF
KEKIDDEYRANMILDNLPVAVLRQRRDGSQSTTYEHGFRVGFKGSYEGSKEEKYFIHNHL
SFRVMYHRDQESDSARIVGFEVTPNSILHEYKEWDEKNPQLTTCNKDTKNLIQGNTVPQE
VEQGKEIVFTYDVSFKESEIKWASRWDTYLLMNDDQIHWFSIINSLMIVLFLSGMVAMIM
MRTLYKDISNYNQLETQDEAQEETGWKLVHGDVFRPPVNSGLLCVYVGTGVQIFGMSLVT
MMFALLGFLSPSNRGGLMTAMVLLWVFMGIFAGYSSSRLHKMFKGNKWKRMTLKTAFMFP
GILFAIFFVLNALIWGEQSSGAIPFGTMFALFCLWFGISVPLVFVGSYLGYKKPAIEDPV
KTNKIPRQVPEQPWYMKPVFSILIGGILPFGAVFIELFFILTSIWLNQFYYIFGFLFIVF
LILIVTCAEITVVLCYFQLCSEDYNWWWRAYLTAGSSAFYLFLYSIFYFFTKLEITKLVS
GMLYFGYMIIISYAFFVLTGTIGFYACFWFVRKIYSSVKID
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagacgaaaggaagtagctttcgattctacgccactctcttactctcttttctc
tctttctccttatctcgcgccttttatctaccaggagtcgctcctcgtgatttccagaag
ggtgatcctctttatgttaaagttaacaaattgtcgtccacaaagactcaacttccttat
gactactactacctgaattactgtaagcctcctaagatcttgaacaatgctgagaattta
ggggaggttctcagaggtgaccgcattgagaattccgtttatacttttcaaatgctggaa
gatcagccctgcaaagtaggttgccgtgttaaacttaatgctgactccaccaagaatttc
aaggaaaagattgatgatgaatacagggctaatatgattcttgataatcttccagtagct
gtactaagacaaaggagagatggaagtcaatcaacgacttatgaacacggttttcgtgtt
ggctttaaagggagttatgaagggagcaaagaggagaaatactttatacataatcacttg
agcttccgagtcatgtaccacagagaccaagagtctgattctgctcgaattgttggattt
gaggttacgcctaacagtatcttgcatgaatacaaggagtgggatgaaaaaaatcctcag
ttaacaacatgtaataaggacacgaagaatctaatccaaggcaacactgtccctcaagaa
gttgagcaaggaaaagaaatagtgtttacatatgatgtctcgtttaaggagagtgaaatc
aaatgggcttctcggtgggacacgtaccttctcatgaacgatgatcaaatccactggttt
tccatcataaattcacttatgattgtccttttcctttctggaatggtagccatgatcatg
atgagaactttatacaaggatatctcaaactacaatcagctcgagacccaagatgaggcc
caggaagagactggatggaagcttgtacacggagatgtcttcaggccaccggtgaactct
ggtttattgtgtgtttatgttggtacaggtgttcagatcttcggaatgtcacttgttaca
atgatgtttgcgttgcttggcttcttatctccatccaacagaggagggcttatgactgcc
atggttctcttgtgggttttcatgggcatattcgctggttactcctcgtctcgccttcac
aaaatgttcaaaggaaacaagtggaagagaatgaccttgaagactgcattcatgtttccc
ggtatcctttttgctatcttctttgttctgaatgcccttatttggggagaacagtcatct
ggagccataccatttggtacaatgtttgctctcttctgcctctggtttggcatctcagtc
ccactagtcttcgttggtagctatctgggttacaagaagccagcaattgaagatccagtc
aaaacaaacaagatcccgaggcaagtaccagagcagccgtggtacatgaaaccagttttc
tctatactaattggaggcattctcccgtttggagcagtcttcatcgagctcttcttcatc
ttgacatctatatggctgaaccagttctactacatcttcgggttcctctttatagttttt
ttgatcttgatcgtcacctgtgcagagatcacagtggtgctctgctacttccagctttgt
agcgaagactacaactggtggtggagagcttacttaactgcgggctcatccgctttctac
ctcttcctctactcaatcttctacttcttcacaaagctggagatcacaaagctagtctcg
ggaatgctctacttcgggtacatgattatcatctcttacgcattcttcgtcctaactggc
acaatcggtttctatgcttgcttctggttcgtgagaaagatctactcctcagtgaagatt
gactag

DBGET integrated database retrieval system