KEGG   Arabidopsis thaliana (thale cress): AT3G13784Help
Entry
AT3G13784         CDS       T00041                                 

Gene name
CWINV5
Definition
(RefSeq) cell wall invertase 5
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00052  Galactose metabolism
ath00500  Starch and sucrose metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AT3G13784 (CWINV5)
   00500 Starch and sucrose metabolism
    AT3G13784 (CWINV5)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AT3G13784 (CWINV5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 820590
NCBI-ProteinID: NP_001326013
MIPS: AT3G13784.1
TAIR: AT3G13784
Araport: AT3G13784
UniProt: Q9LIB9
Position
3
AA seq 572 aa AA seqDB search
MANIVWCNIAMFLLVSLFLTDDAVVVLDALDNVPNNIKNQPYRTGYHFQPPKNWMNDPNG
PMIYKGIYHLFYQWNQNGAVMDVNKTVWGHATSTDLINWITLSPAIRPSRPSDINGCWSG
SVTILPNGKPVILYTGNDRYNRQVQNLVKPKNLTDPYLRHWTKSPENPLVTPSPVNHINS
SAFRDPTTAWFGRDGRWRITTGSQEGRRGLAILHTSKDFVIWKQSPKPLHYHDGTGMWEC
PDFFPVARTDSRGLDTSFSSGPMVKHVLKVSLTDTFNDYYTIGTYDEVRDVYVPDKGFVQ
DETAPRYDYGKFYASKTFYDSVNQRRILWGWVNESSPEKDNIKKGWAGLQAIPRKVWLDE
SGKRLVQWPVKEIERLRTTQVKWGNKLLKGGSVMEVHGVTAPQADVEVFFKVSGFDLEKA
DVIEPGWTDPQLICSQRNASSGLGPFGLMVLASKNMEEYTSVNIRIFRAGENSKEHVVVM
CSDQSTSSLEKGNDKTTYGAFLDISPYQPISLRTLIDKSIVESFGGKGKTCITSRVYPKL
AIGERTHLFAFNKGSQNVNVLSLSAWSMKSSL
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggctaatatagtttggtgtaacattgccatgttcttgttggtctcgttgtttctcact
gacgatgctgttgttgttcttgatgccttggacaacgttcccaataatatcaagaaccaa
ccttaccgaaccggttatcatttccagcctcccaaaaattggatgaacgatcctaacggg
cctatgatatacaaaggaatctatcatctattctatcaatggaaccaaaacggcgccgtc
atggacgttaacaaaaccgtatggggccatgcaacatcaacggatctaatcaactggatc
acactttctccagcaatcagaccatctcgaccgtccgatattaacggatgctggtccggc
tccgtcacgattctccctaatggcaaacctgtaattctttacaccggcaacgaccgttat
aaccgccaggtccaaaacttagttaaacctaaaaacctcaccgatccatatctacggcac
tggaccaaatcgccggaaaatcccctcgtgacacctagccccgtcaaccacatcaactcc
agcgcgtttcgtgatccaaccaccgcgtggtttggccgtgacgggcgttggcgcataacc
accggaagccaagaaggtcgacgtggattagcgattctacacacgagcaaagatttcgta
atatggaagcaatctccaaagcctcttcattaccacgacggtaccggaatgtgggagtgc
cctgattttttcccggtggctagaactgattcacggggcctagatacgtctttttcaagt
gggccgatggttaaacacgtccttaaagtgagcttaacagatacgtttaatgattactac
acgattggtacgtacgatgaagtgagagatgtctacgtaccggacaagggttttgttcag
gacgaaacggctccgagatatgattacggcaaattttatgcgtcgaaaacattttacgac
tctgttaatcagcgcaggattttgtggggttgggttaacgagtcgtcaccggagaaagat
aacatcaagaagggttgggccggtttacaggctattcctaggaaagtatggcttgatgaa
tcaggaaagagattggtgcaatggccggttaaggaaatagagaggttacgtacaacgcaa
gtcaagtggggaaacaaactattgaaaggagggtcggtaatggaggttcatggagtcaca
gctccacaagcagatgtggaagttttcttcaaagtgagtggttttgacttagagaaagca
gatgtgattgaaccgggctggaccgatccgcaattgatctgcagtcagaggaatgcgtca
tcaggtttaggtccattcggtttaatggttctagcttccaagaacatggaagagtataca
tcggtcaatatcagaatcttcagagctggtgagaatagtaaggagcacgtagtggtcatg
tgcagtgaccaaagcacatcaagtttagagaaagggaatgataaaacaacttatggtgct
tttttagatatctctccttatcaaccaatctctctcaggactttgattgataaatcaata
gtggagagctttggtgggaaagggaaaacatgtattacctcgagagtttatccaaaattg
gcaataggagaaagaacacatctctttgcttttaacaagggatctcaaaatgttaatgtt
ttaagcctaagtgcttggagcatgaagtcttctctttaa

DBGET integrated database retrieval system