KEGG   Arabidopsis thaliana (thale cress): AT3G14070
Entry
AT3G14070         CDS       T00041                                 
Symbol
CAX9
Name
(RefSeq) cation exchanger 9
  KO
K13754  solute carrier family 24 (sodium/potassium/calcium exchanger), member 6
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT3G14070 (CAX9)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC24: Na+/(Ca2+-K+) exchanger
   AT3G14070 (CAX9)
SSDB
Motif
Pfam: Na_Ca_ex UPF0182
Other DBs
NCBI-GeneID: 820622
NCBI-ProteinID: NP_566474
TAIR: AT3G14070
UniProt: Q9LJI2 A0A7G2EKS5
Position
3:complement(4660944..4663363)
AA seq 643 aa
MSAVSFLYSSKTPKFRGVFNGICALVLFCFFFDRSELLRNPLLRNASFVNGGSGSTSGGI
TQFMVIRRNARQIETNGSGNNSSLSSSSTVLCSGLHKHMGYADQCEFLKANPICSPDGFF
DYLSFFYCSCRDFSILGYMMLGVWLVALFYLLGNTAADYFCCSLEKLSKLLRLPPTVAGV
TLLPLGNGAPDVFASIAAFVGTDKGEVGLNSVLGGAVFVTSVVVGIVSLCVADKEVKIDK
NCFIRDLSFFLFSLVSLLVILMVGRVTVRIAIAFVSIYVVYAFLVAANVILRKHAKRFKL
EALTPLLPMQGSVFSPSVGEDMPMNTPLIETETEDGPPRLQSLPQWMWASNVAIYSNHFA
KVSVHDEDRPPWGWIDDTAEVESSSCTKFTSLLEIPLTIPRRLTIPSVEEDTWSKTYAVA
SVSLAPVLLASLWSSQDDVSLQACGVAYFFSVVIGSTLGFLAYKNTEPDHPPRRFLIPWV
LGGFIMSIVWFYMIANELVALLVTFGEIYGINPSILALTVLAWGNSMGDLVSNIALTMNG
GDGVQIALSGCYAGPMFNTLVGLGMSMLFGAWSKSPDTYMLPEDKSLFYTLGFLVLGLVW
AMVILPRNDMQPSRTLGVGLIAIYLIFVTFRLSCAMGFIPWAA
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgagcgcggttagttttctttacagctcgaaaacccccaaatttcgaggggttttcaat
gggatttgtgctctggttctgttttgcttcttctttgatcggagcgaattactcagaaac
cctttgttaaggaacgcgtctttcgtcaatggtggtagtggctcaacctccggaggtatc
acccagtttatggtaattcgtagaaatgcgaggcaaattgaaacgaatggttctggtaat
aatagcagcttgagtagcagtagtactgttttatgctcagggttacacaaacacatgggt
tatgctgatcaatgcgagttcttaaaagcaaacccaatttgttcccctgatggattcttt
gattacctcagcttcttttactgctcctgtagagatttcagtatcttgggttacatgatg
ttaggtgtttggcttgttgctttgttttatctgttgggtaatactgctgctgattacttt
tgttgttcactggagaagctttcaaagcttttgaggctgcctccaactgttgctggtgtt
actttacttcctcttgggaatggagcaccagatgtgtttgctagtatagctgcttttgtt
ggtacagataaaggagaagttggtcttaacagcgtcttgggtggtgctgtgtttgttact
tctgttgttgtagggattgtttcgctttgtgttgcggataaggaagtcaagatcgataag
aattgcttcatcagagacttgagtttcttccttttctcgcttgtgtctttgctggtgatt
ttgatggttggtagagtgacagtccggattgccatcgcgtttgtctcaatatatgtggtt
tatgctttccttgtggcagcgaatgtgattctgagaaaacatgctaagaggtttaaacta
gaggctcttactcctttgctacctatgcaaggaagtgtgttttccccgagtgttggagag
gatatgccaatgaatacccccttgatagaaactgagactgaggatggtccacctcggcta
cagagtcttcctcagtggatgtgggcgtcaaatgtggccatctattcaaaccatttcgca
aaagttagtgtacatgatgaagacaggccaccttggggatggattgatgacactgcagaa
gtagagagctcctcatgtactaaattcacttccttgttggaaattccgctgaccattcca
aggagattaacaattccatcggtcgaagaagatacatggtcaaagacatatgctgtggcc
agcgtctcattagcgcctgtccttttggcgtctctctggagtagccaagacgatgtgagt
ctccaagcttgtggtgtcgcatactttttcagcgttgttataggctccactcttggcttt
ctggcttacaaaaacacagaacctgatcacccacctcgaagattcttgatcccttgggtt
cttggtgggtttataatgagcatcgtatggttctacatgatagcaaacgaactcgttgct
cttctggtgacatttggtgagatttacggaatcaacccgtcgatacttgcgctaacagta
cttgcttggggaaactcaatgggtgacttagtatcgaatatcgcattgacaatgaacggt
ggggatggtgtacaaatcgctctatcgggatgctacgccggtccaatgttcaacacactc
gtcgggctaggtatgtcgatgctttttggcgcatggtccaagagtcctgacacatacatg
ctaccagaagacaaaagcctattctacacacttgggtttctagtactcggtttggtttgg
gctatggtgatactcccgcgcaacgacatgcaacctagcagaaccttaggtgttggactc
attgcaatatatctgatattcgtcactttcaggctgagctgcgccatgggattcatacca
tgggctgcttaa

DBGET integrated database retrieval system