KEGG   Arabidopsis thaliana (thale cress): AT3G14810
Entry
AT3G14810         CDS       T00041                                 

Symbol
MSL5
Name
(RefSeq) mechanosensitive channel of small conductance-like 5
  KO
K22048  mechanosensitive ion channel protein 4/5/6/7/8/9/10
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT3G14810 (MSL5)
Transporters [BR:ath02000]
 Other transporters
  Pores ion channels [TC:1]
   AT3G14810 (MSL5)
SSDB
Motif
Pfam: MS_channel
Other DBs
NCBI-GeneID: 820710
NCBI-ProteinID: NP_188099
TAIR: AT3G14810
UniProt: Q9LH74 A0A178VCQ0
Position
3:complement(4970944..4974534)
AA seq 881 aa
MAAVDSTDRRDFIVNINGQESGAVGATGSSSNAEGGNIWKESSYDFWDGEKGKNDKKGDD
EDEDGGSFHFRQRGERRHSSAELSDPPSKLIGQFLHKQRASGDEISLDVELNMAELQSNT
PPRPATASNTPRRGLTTISESSSPVKTKVKADAVRRRQNRTSLGGSSDEEGRNRDEAEVL
KCGSKKPMLSRNKTKSRLQDPPTPTHPAIDKTEMKSGRRSGIFKSGFLGKSPKAGTPGRN
GFEEEEEEDPFLDEDLPEEFKRDKLSFWVFLEWISLVLIVTSLVCSLTIHNLQRKTWWKL
DLWKWEVTVLVLICGRLVSSWIVRIIVFLVEKNFTWRKRVLYFVYGVRKSVQNCLWLGLV
LLAWHFLFDKKVERETRSTALRYVTRVLVCLLVALIIWLVKTILVKVLASSFHMSTYFDR
IQESLFTQYVIETLSGPPLMEIQRMEEEEQQVAEDVKSLEKLAGAKLPPALKATVKSFMK
VGKSPGLNRIGSKRGEDGEGIRIDQLKRMNTKNVSAWNMKRLMNIILKGAISTLDQNMQD
TTQEDEDATHIRSEYEAKCAARKIFHNVTEPGSRYIYLEDFLRFLCEEEAERAMALFEGA
SESDKISKSCLKNWVVKAFRERRALALTLNDTKTAVDRLHRIINVVIGIIIIIIWLLILG
IATTRFLLVLSSQLLLVAFVFGNSCKTIFEAIIFLFVMHPFDVGDRCEIDGVQLVVEEMN
ILTTVFLRYDNQKIIYPNSVLGTKPIANYYRSPDMGDAVEFCVHIATPPEKITAIKQRIL
SYVDNKKDYWYPAPMIVFLSMDDLNSVKIAVWLTHRMNHQDMGERYIRRGLLLEEVGKTC
RELDIEYRLYPLNINVRSLPPTANPTSSDRIPPSWMQQRGP
NT seq 2646 nt   +upstreamnt  +downstreamnt
atggcggctgtcgattcaactgatcggcgggacttcatagtgaacatcaacggccaagag
agtggagccgtcggtgctacagggtcaagcagcaatgctgagggaggtaatatttggaaa
gagtcaagctatgacttttgggatggtgaaaagggtaagaatgataagaaaggagacgac
gaagacgaagacggcggcagtttccatttcaggcagcggggagagcggaggcattcgtca
gctgagttatctgatccgccgtcgaagctaattggtcagtttcttcacaagcagagagct
tcaggagatgagatctctttagatgttgagcttaacatggcagagctacagagcaacacg
ccgccacgtcctgcaactgctagcaacacgccgcgacgtggcttaacgacgatttctgaa
tcttcttctccggttaagactaaagttaaagcagacgcagtaagacggaggcagaacaga
acatcgctaggtggaagtagcgacgaggaaggtcgaaacagagacgaagcagaggttttg
aagtgtggttcgaagaaaccgatgttgagtaggaacaagaccaaatcaagattgcaggat
cctccaacaccgacacatccagcgattgacaagacagagatgaagtctggtcggagatcc
gggatttttaaatctgggtttcttgggaaaagccctaaagcgggtactccgggtcggaat
gggtttgaggaagaagaagaggaggatccgtttctagacgaggatttaccggaggaattc
aaaagggacaaacttagcttctgggttttccttgaatggataagtctagttctgatagtc
acaagtttggtctgtagcttaaccatacataacttgcaacgcaagacatggtggaagctg
gatttgtggaaatgggaagtgactgttttggtgttgatatgtgggagattagtctcgagt
tggatagtgagaatcattgtcttcttggtcgagaaaaacttcacttggaggaaaagggtt
ttgtatttcgtctacggagtgagaaaatctgttcaaaactgcttgtggttagggctagtg
ttgctcgcgtggcatttcttgttcgataagaaagtcgaaagagagactcggagcactgct
cttcggtatgtgacgagagtgttggtatgtttgcttgtggctcttatcatttggttggtt
aaaacaattctggttaaagttttggcttcatcgttccacatgagcacttactttgatcgg
attcaggagtcgttgttcactcaatacgtgattgaaactctctccggtcctcctttgatg
gagattcagagaatggaggaagaagagcaacaagtagcagaagatgttaagagcttagag
aaattagccggagctaagctgcctccagctctaaaagcgaccgtcaagagttttatgaaa
gtcgggaaaagtccgggactgaatcggattggttctaagagaggagaagatggcgaaggg
attaggattgatcagttgaagagaatgaacacaaagaatgtgtctgcttggaacatgaag
agattgatgaatataatactaaaaggcgctatttctactttggatcaaaatatgcaggac
actactcaggaggatgaggacgctacgcatataagaagcgagtacgaagctaaatgcgca
gctaggaagatttttcacaacgtcaccgagccaggttctaggtacatatatttggaagac
ttcttgcgttttctatgtgaagaggaggctgaaagagccatggctctctttgaaggagct
tcagagagcgataagatcagcaagtcttgcctcaagaattgggtggttaaggcgtttaga
gaaaggagagctctggctttgaccttaaacgatacaaaaacagcagtggacagacttcac
cgtataatcaacgtggtaattggcattataatcataatcatctggcttcttatactagga
atcgccacaaccagattcttgctagtcttaagctctcagctccttctagtagcctttgta
tttggaaactcctgcaaaaccatcttcgaagccatcattttcctttttgttatgcaccca
tttgatgtcggtgaccgatgtgaaatcgacggtgttcagttggtagtggaggagatgaac
atattgacgactgttttcttgcgatatgataatcaaaagatcatatatccgaatagtgtc
ctcggcacaaaacctatagctaactattaccgaagtcccgatatgggagacgcggttgaa
ttctgtgttcatatagcaactcctcctgaaaagatcactgccattaaacagagaatacta
agttacgtagacaacaagaaggattattggtatcctgcacctatgattgtgttcctaagc
atggatgacttgaatagtgtgaagatagcggtgtggttgacacatagaatgaatcatcaa
gacatgggagagaggtatataagaagaggtctattactagaggaagtgggaaaaacttgt
agagagctagatatcgagtatcgcttatatcctcttaacattaatgttcgaagtctccct
cctacggctaatccaacttcttcagaccgcattcctccttcatggatgcaacaacgcggt
ccttga

DBGET integrated database retrieval system