KEGG   Arabidopsis thaliana (thale cress): AT3G15210Help
Entry
AT3G15210         CDS       T00041                                 

Gene name
ERF4
Definition
(RefSeq) ethylene responsive element binding factor 4
  KO
K09286  EREBP-like factor
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT3G15210 (ERF4)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Other transcription factors
   EREBP
    AT3G15210 (ERF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AP2
Motif
Other DBs
NCBI-GeneID: 820752
NCBI-ProteinID: NP_188139
MIPS: AT3G15210.1
TAIR: AT3G15210
Araport: AT3G15210
UniProt: O80340 A0A178VDX3
Position
3
AA seq 222 aa AA seqDB search
MAKMGLKPDPATTNQTHNNAKEIRYRGVRKRPWGRYAAEIRDPGKKTRVWLGTFDTAEEA
ARAYDTAARDFRGAKAKTNFPTFLELSDQKVPTGFARSPSQSSTLDCASPPTLVVPSATA
GNVPPQLELSLGGGGGGSCYQIPMSRPVYFLDLMGIGNVGRGQPPPVTSAFRSPVVHVAT
KMACGAQSDSDSSSVVDFEGGMEKRSQLLDLDLNLPPPSEQA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatgggcttgaaacccgacccggctactactaaccagacccacaataatgcc
aaggagattcgttacagaggcgttaggaagcgtccttggggccgttatgccgccgagatc
cgagatccgggcaagaaaacccgcgtctggcttggcactttcgatacggctgaagaggcg
gcgcgtgcttacgatacggcggcgcgtgattttcgtggtgctaaggctaagaccaatttc
ccaacttttctcgagctgagtgaccagaaggtccctaccggtttcgcgcgtagccctagc
cagagcagcacgctcgactgtgcttctcctccgacgttagttgtgccttcagcgacggct
gggaatgttcccccgcagctcgagcttagtctcggcggaggaggcggcggctcgtgttat
cagatcccgatgtcgcgtcctgtctactttttggacctgatggggatcggtaacgtaggt
cgtggtcagcctcctcctgtgacatcggcgtttagatcgccggtggtgcatgttgcgacg
aagatggcttgtggtgcccaaagcgactctgattcgtcatcggtcgttgatttcgaaggt
gggatggagaagagatctcagctgttagatctagatcttaatttgcctcctccatcggaa
caggcctga

DBGET integrated database retrieval system