KEGG   Arabidopsis thaliana (thale cress): AT3G15720
Entry
AT3G15720         CDS       T00041                                 
Name
(RefSeq) Pectin lyase-like superfamily protein
  KO
K01184  polygalacturonase [EC:3.2.1.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00040  Pentose and glucuronate interconversions
ath01100  Metabolic pathways
Module
ath_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AT3G15720
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.15  endo-polygalacturonase
     AT3G15720
SSDB
Motif
Pfam: Glyco_hydro_28 Pectate_lyase_3 Beta_helix End_N_terminal
Other DBs
NCBI-GeneID: 820815
NCBI-ProteinID: NP_566524
TAIR: AT3G15720
UniProt: Q9LW07
Position
3:complement(5325127..5327672)
AA seq 456 aa
MKKKTWFLNFSLFFLQIFTSSNALDVTQFGAVGDGVTDDSQAFLKAWEAVCSGTGDGQFV
VPAGMTFMLQPLKFQGSCKSTPVFVQMLGKLVAPSKGNWKGDKDQWILFTDIEGLVIEGD
GEINGQGSSWWEHKGSRPTALKFRSCNNLRLSGLTHLDSPMAHIHISECNYVTISSLRIN
APESSPNTDGIDVGASSNVVIQDCIIATGDDCIAINSGTSNIHISGIDCGPGHGISIGSL
GKDGETATVENVCVQNCNFRGTMNGARIKTWQGGSGYARMITFNGITLDNVENPIIIDQF
YNGGDSDNAKDRKSSAVEVSKVVFSNFIGTSKSEYGVDFRCSERVPCTEIFLRDMKIETA
SSGSGQVAQGQCLNVRGASTIAVPGLECLELSTDMFSSAQLLEQTCMSAQSVQPRTTTQP
MQDPIWVFQSRGKQLRVYNIAILVSFISLVTYILAR
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaagaagaagacttggttcttgaatttctcactgttctttcttcaaatcttcacatct
tcgaatgcattggatgttactcaattcggagcggttggagatggagttacagacgattca
caggcgttcttgaaagcttgggaagctgtgtgtagcggaacaggagatgggcagtttgtc
gttccggcagggatgacatttatgttacagcccctgaagtttcaagggtcttgcaaatcc
acccctgtttttgttcagatgttaggcaagctggttgcaccgagtaaaggaaattggaaa
ggggacaaagatcaatggattctttttacagacattgaaggacttgtgattgaaggtgac
ggtgaaattaacggccagggttcgagctggtgggaacacaaaggctctagacctaccgca
ttgaagttcaggagctgcaacaaccttagattgagtgggttaacgcatttagatagtcca
atggctcacattcacataagcgagtgcaactatgtgaccatctcaagcctacgaataaat
gcacctgaatcaagtcctaacaccgatggaatcgacgtaggggcttcatccaacgttgtc
atccaggattgcatcatcgcaaccggtgatgattgcattgcgattaattcggggacgtct
aacatccacatttccggtatagattgcggaccaggccatgggataagcataggaagcttg
ggaaaagatggagagacagctacagtggagaatgtatgtgtccaaaactgtaactttaga
ggaactatgaatggagctcggatcaaaacttggcagggcggatcgggttacgcgagaatg
attactttcaatggaattactctagacaatgttgaaaatccaatcataatcgatcagttc
tataacggtggcgattccgataatgccaaagatcgtaagtcgtcggcagtggaagtgagc
aaagtggtgtttagtaatttcattgggacgtcaaagtcagagtacggtgttgacttccga
tgcagcgagagagttccatgcacagagattttcttgagagacatgaaaatagaaacggca
tcatcaggatcaggacaagtcgcacaaggacagtgtttaaacgtgagaggtgcgtctaca
attgctgtaccaggtctagaatgtttagaactttccacagatatgttttcatcggcgcaa
ttgctggaacaaacttgcatgtcggcacaatcagtgcaaccaagaacaacaacacaaccg
atgcaagatccaatatgggtttttcaaagcagagggaaacaacttagagtttacaatatt
gccatattagtttcatttatctctttggttacatatattttagctagatag

DBGET integrated database retrieval system