KEGG   Arabidopsis thaliana (thale cress): AT3G15930Help
Entry
AT3G15930         CDS       T00041                                 

Definition
(RefSeq) Pentatricopeptide repeat (PPR) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR PPR_1 PPR_3 PPR_long DYW_deaminase DUF3213
Motif
Other DBs
NCBI-GeneID: 820836
NCBI-ProteinID: NP_188214
MIPS: AT3G15930.1
TAIR: AT3G15930
Araport: AT3G15930
UniProt: Q9LSB8
Position
3
AA seq 687 aa AA seqDB search
MILRNPLKSPFNSELSIFKALLMSTITESISNDYSRFISILGVCKTTDQFKQLHSQSITR
GVAPNPTFQKKLFVFWCSRLGGHVSYAYKLFVKIPEPDVVVWNNMIKGWSKVDCDGEGVR
LYLNMLKEGVTPDSHTFPFLLNGLKRDGGALACGKKLHCHVVKFGLGSNLYVQNALVKMY
SLCGLMDMARGVFDRRCKEDVFSWNLMISGYNRMKEYEESIELLVEMERNLVSPTSVTLL
LVLSACSKVKDKDLCKRVHEYVSECKTEPSLRLENALVNAYAACGEMDIAVRIFRSMKAR
DVISWTSIVKGYVERGNLKLARTYFDQMPVRDRISWTIMIDGYLRAGCFNESLEIFREMQ
SAGMIPDEFTMVSVLTACAHLGSLEIGEWIKTYIDKNKIKNDVVVGNALIDMYFKCGCSE
KAQKVFHDMDQRDKFTWTAMVVGLANNGQGQEAIKVFFQMQDMSIQPDDITYLGVLSACN
HSGMVDQARKFFAKMRSDHRIEPSLVHYGCMVDMLGRAGLVKEAYEILRKMPMNPNSIVW
GALLGASRLHNDEPMAELAAKKILELEPDNGAVYALLCNIYAGCKRWKDLREVRRKIVDV
AIKKTPGFSLIEVNGFAHEFVAGDKSHLQSEEIYMKLEELAQESTFAAYLPDTSELLFEA
GDAYSVANRFVRLSGHPGTKNWKSTVR
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgattctgcgaaacccactaaaatctccttttaactctgaactatcgatcttcaaggca
ctgctcatgtcaacgatcacagaatctatatccaatgattactctcgtttcatctctatc
cttggagtttgcaaaacgacggaccaattcaagcaattacattcacaaagcattacgaga
ggtgtagcaccaaacccaacattccaaaagaagctctttgtcttctggtgtagtcgttta
ggtggccatgtgagttatgcatacaagctgtttgtgaaaatacctgaaccagacgtggtt
gtgtggaacaatatgatcaaaggttggtcaaaggtggattgtgatggtgaaggagttaga
ttgtatttgaatatgttgaaggaaggtgtgactccggatagccacacgtttcctttcttg
ttgaacggtcttaagcgtgatggaggagctttggcttgtggtaagaagctgcattgccat
gttgtgaaatttggattaggttctaatctttatgtgcagaatgctcttgtgaaaatgtac
tctttatgtggactaatggatatggctcgtggggttttcgacaggagatgcaaagaggat
gtgttctcgtggaacttgatgatctctgggtacaacaggatgaaagagtatgaagaaagc
attgagcttttagtggagatggagaggaacttggtttctccaacttctgttaccttactt
cttgttctctcggcttgttctaaggtgaaagataaggatctctgtaaaagggttcatgag
tatgttagtgagtgtaagactgaacccagtttgagattggaaaatgctctggtcaatgca
tatgctgcgtgcggggaaatggatatagcggtgaggattttcaggagtatgaaagctagg
gatgtgatttcttggacatctatcgtgaaagggtatgttgagagagggaatctgaagttg
gcaaggacatattttgatcagatgccagtgagagacagaatttcgtggactattatgatt
gacggttacctacgagctggttgcttcaatgaatctctggaaatattccgagagatgcaa
agtgcaggtatgatacccgatgaattcaccatggttagtgttctcacagcttgtgctcat
ctgggttccttggagataggtgaatggattaagacatacatagacaaaaacaagatcaag
aacgatgttgttgtggggaatgctttgatcgatatgtatttcaaatgtgggtgttctgag
aaagcacagaaggttttccatgacatggatcagagagacaaattcacatggacagccatg
gttgttggtcttgccaacaatggacaaggtcaagaggccattaaagttttctttcaaatg
caagacatgtcaatacaaccagatgacattacttaccttggcgtcctctctgcttgtaac
catagtggtatggtagaccaagcaaggaaattttttgccaagatgagaagcgaccataga
attgagccaagtttagtacattacggatgtatggttgacatgcttggtcgagctgggcta
gttaaggaagcatatgagatactaaggaaaatgccaatgaatccaaactcgattgtgtgg
ggagctctacttggggcttctagacttcataatgatgaaccaatggctgaattggcggct
aagaaaatccttgagttagaacctgataatggggctgtttatgctttgttatgcaatata
tatgcaggttgcaaaagatggaaggatttgcgagaagtgagaagaaagatcgtggacgtt
gcaattaagaagacaccaggctttagtttaattgaggtaaacggttttgctcatgaattt
gttgctggagacaaatcacatcttcaatctgaagagatttacatgaaactagaagaatta
gcccaagagtcgacatttgcagcatacttgcctgatacttccgaattattgttcgaggct
ggggatgcctacagtgtggctaacagatttgtccgattgtcgggacacccaggaacaaag
aactggaagagcacagtcaggtaa

DBGET integrated database retrieval system