KEGG   Arabidopsis thaliana (thale cress): AT3G16150Help
Entry
AT3G16150         CDS       T00041                                 

Gene name
ASPGB1
Definition
(RefSeq) N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein
  KO
K13051  beta-aspartyl-peptidase (threonine type) [EC:3.4.19.5]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ath01002]
    AT3G16150 (ASPGB1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.5  beta-aspartyl-peptidase
     AT3G16150 (ASPGB1)
Peptidases [BR:ath01002]
 Threonine Peptidases
  Family T2
   AT3G16150 (ASPGB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asparaginase_2
Motif
Other DBs
NCBI-GeneID: 820860
NCBI-ProteinID: NP_566536
MIPS: AT3G16150.1
TAIR: AT3G16150
Araport: AT3G16150
UniProt: Q8GXG1 Q29Q32 A0A384KV24
Position
3
AA seq 325 aa AA seqDB search
MGGWAIAVHGGAGIDPNLPAERQEEAKQLLTRCLNLGIIALRSNVSAIDVVELVIRELET
DPLFNSGRGSALTEKGTVEMEASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYL
AFSGAEDFARKQGVEIVDNEYFVTDDNVGMLKLAKEANSILFDYRIPPMGCAGAAATDSP
IQMNGLPISIYAPETVGCVVVDGKGHCAAGTSTGGLMNKMMGRIGDSPLIGAGTYASEFC
GVSCTGEGEAIIRATLARDVSAVMEYKGLNLQEAVDYVIKHRLDEGFAGLIAVSNKGEVV
CGFNSNGMFRGCATEDGFMEVAIWE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggtgggcaatcgcagtacacggtggtgccggtatcgaccctaatcttccggcg
gagagacaagaagaggctaaacagcttttaactcgttgtctcaacctcggcataatagct
ttgcgttccaatgtctccgccattgacgtcgttgagctcgtcattagagaattggagacg
gatcctctgtttaattcaggccgtggatctgctttgacggaaaaaggaacggttgagatg
gaagctagcattatggacggtacgaagagacgatgcggtgccgtttcggggataaccacc
gtgaaaaatcctatatctcttgctcgtctcgtcatggacaaatctccccactcttacctt
gctttctcaggtgcagaggatttcgcccgcaaacagggagttgaaattgtggacaacgag
tactttgtcacggacgacaacgtaggaatgctcaagttggccaaggaagctaactccatc
ttgtttgattaccggattccgccgatgggatgtgccggtgcagctgcgaccgacagtcca
atccaaatgaacggtcttccgatcagcatttacgcaccggagacagtcgggtgcgttgtg
gttgacgggaaaggacattgtgccgccgggacatccacgggtggtttaatgaacaagatg
atgggaaggattggtgactcgccgctgataggagccgggacgtatgcgtcggagttttgt
ggtgtgtcgtgtaccggagaaggagaagccattataagagcaaccctagctcgtgatgtg
tcagctgttatggagtataaaggacttaacctccaagaagcggttgattacgtcatcaag
catcgacttgacgaagggttcgctggactcattgctgtctcgaataaaggagaggtggtt
tgtggttttaactctaatgggatgttcaggggatgtgcaactgaggatggattcatggag
gttgctatttgggagtga

DBGET integrated database retrieval system