KEGG   Arabidopsis thaliana (thale cress): AT3G17040
Entry
AT3G17040         CDS       T00041                                 

Gene name
HCF107
Definition
(RefSeq) high chlorophyll fluorescent 107
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: TPR_2 TPR_14 TPR_12 TPR_19 TPR_16 TPR_17 TPR_1 ANAPC3 TPR_11 TPR_10 TPR_15 SNAP TPR_MalT
Other DBs
NCBI-GeneID: 820961
NCBI-ProteinID: NP_188329
MIPS: AT3G17040.1
TAIR: AT3G17040
UniProt: Q8RWG2
Position
3
AA seq 652 aa
MHFFFVPNSSSSSPSPANTSSFSLSFLTPQIPENLCKSPTKIHIGTHGISGQSFLSHPTF
SSKNTYLYAVVDRSSSGVFSPQKESANGEGEESNTEEGVLVVRRPLLENSDKESSEEEGK
KYPARIDAGLSNIAKKMPIFEPERSESSSSSSAAAAARAQERPLAVNLDLSLYKAKVLAR
NFRYKDAEKILEKCIAYWPEDGRPYVALGKILSKQSKLAEARILYEKGCQSTQGENSYIW
QCWAVLENRLGNVRRARELFDAATVADKKHVAAWHGWANLEIKQGNISKARNLLAKGLKF
CGRNEYIYQTLALLEAKAGRYEQARYLFKQATICNSRSCASWLAWAQLEIQQERYPAARK
LFEKAVQASPKNRFAWHVWGVFEAGVGNVERGRKLLKIGHALNPRDPVLLQSLGLLEYKH
SSANLARALLRRASELDPRHQPVWIAWGWMEWKEGNTTTARELYQRALSIDANTESASRC
LQAWGVLEQRAGNLSAARRLFRSSLNINSQSYVTWMTWAQLEEDQGDTERAEEIRNLYFQ
QRTEVVDDASWVTGFLDIIDPALDTVKRLLNFGQNNDNNRLTTTLRNMNRTKDSQSNQQP
ESSAGREDIETGSGFNLDVFLRSKLSLDPLKLDVNLDSKRLERFTRGRINGA
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgcacttcttcttcgtgccgaattcttcgtcttcatctccttctccggccaatacttct
tcattctcgctatcgtttctcactcctcaaattcctgagaatctctgtaagtcaccgacg
aaaatccacatcggaactcatggaatctccggtcaatcgtttctcagtcatcctactttc
tcatctaagaacacgtatctgtatgcagtcgtcgacaggtcttcttcaggtgtattttcg
ccgcaaaaggaatctgccaatggcgagggagaggaatctaacacggaggagggagtatta
gtagttcgacggccgttgttggagaattccgataaggaatctagtgaggaagagggaaaa
aagtatccagcgaggatcgatgctggtctgagtaatatagctaagaagatgccgatattt
gagccggagagatcggaatcgtcgtcgtcatcttcagccgctgctgctgcaagagctcaa
gagagaccgcttgcggtgaatttggacttgtctctgtacaaagcaaaggttttggcgaga
aatttcagatacaaagacgccgagaagattctagagaagtgcatagcttactggccggag
gatgggagaccgtacgtggcattggggaagatactaagcaaacaatccaagttagctgaa
gctcgaatcctgtatgaaaaagggtgtcaatctacacaaggagagaattcatacatttgg
cagtgttgggctgtcctggaaaacaggttgggaaatgtaagaagagccagggagttgttt
gatgcagccacggtggctgacaagaagcatgtagcagcctggcatggatgggcaaacctg
gagataaaacaaggaaatataagtaaagcaaggaatcttctagccaaaggcctcaagttt
tgtggcagaaacgagtatatctaccaaacacttgccttgttggaggccaaagctggccgg
tatgaacaggcaaggtacctgttcaagcaggcgactatatgcaattcaaggagttgtgcc
agttggttggcatgggcacagttggaaatacagcaggaaagatacccagctgctagaaag
ctttttgagaaagctgtccaggcaagccccaagaatagatttgcgtggcacgtatggggg
gtgtttgaagctggagtaggtaatgttgagcgtggaagaaagctcctgaagataggtcat
gcgctaaatcctagagaccctgttctccttcagtcccttggcttactggagtacaaacat
tcatctgctaatcttgcccgggctttactaaggagagcatcagagctcgatcctagacat
caacctgtttggattgcttggggttggatggaatggaaagaaggaaacacaacaacagct
agagaactttaccaaagagctctctccattgatgcaaataccgaaagtgcttctcgctgt
ctacaggcgtggggagttctcgagcagagagcaggaaacttatcagcagcaagaagatta
ttcagatcttcattgaacattaactcacaaagctacgttacatggatgacatgggcacaa
cttgaggaagatcaaggagacaccgaacgtgctgaagaaatccgtaacctctattttcaa
caacgcacagaggttgttgatgatgcttcgtgggtcacaggattcttggatattattgac
ccggctttagacaccgttaaaaggctcttgaactttggtcagaacaatgacaacaacaga
ttaactactactcttagaaacatgaatagaaccaaagatagccaatccaatcagcaaccc
gagagctctgcgggacgcgaggacattgaaactgggagcgggtttaacctcgatgtattt
ttacgctcgaagctgtcgttggatcctttgaagctggacgttaatcttgattctaagagg
ttagagagattcactagaggaagaataaatggtgcttga

DBGET integrated database retrieval system