KEGG   Arabidopsis thaliana (thale cress): AT3G17240Help
Entry
AT3G17240         CDS       T00041                                 

Gene name
mtLPD2
Definition
(RefSeq) lipoamide dehydrogenase 2
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00020  Citrate cycle (TCA cycle)
ath00260  Glycine, serine and threonine metabolism
ath00280  Valine, leucine and isoleucine degradation
ath00310  Lysine degradation
ath00380  Tryptophan metabolism
ath00620  Pyruvate metabolism
ath00630  Glyoxylate and dicarboxylate metabolism
ath00640  Propanoate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
ath_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
ath_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT3G17240 (mtLPD2)
   00020 Citrate cycle (TCA cycle)
    AT3G17240 (mtLPD2)
   00620 Pyruvate metabolism
    AT3G17240 (mtLPD2)
   00630 Glyoxylate and dicarboxylate metabolism
    AT3G17240 (mtLPD2)
   00640 Propanoate metabolism
    AT3G17240 (mtLPD2)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT3G17240 (mtLPD2)
   00280 Valine, leucine and isoleucine degradation
    AT3G17240 (mtLPD2)
   00310 Lysine degradation
    AT3G17240 (mtLPD2)
   00380 Tryptophan metabolism
    AT3G17240 (mtLPD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT3G17240 (mtLPD2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     AT3G17240 (mtLPD2)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AT3G17240 (mtLPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored GIDA FAD_binding_2 NAD_binding_8 3HCDH_N FAD_binding_3 HI0933_like AlaDh_PNT_C Thi4 K_oxygenase Lycopene_cycl UDPG_MGDP_dh_N DAO
Motif
Other DBs
NCBI-GeneID: 820984
NCBI-ProteinID: NP_566570
MIPS: AT3G17240.1
TAIR: AT3G17240
Araport: AT3G17240
UniProt: Q9M5K2
Position
3
AA seq 507 aa AA seqDB search
MAMASLARRKAYFLTRNISNSPTDAFRFSFSLTRGFASSGSDDNDVVIIGGGPGGYVAAI
KAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAKHVFANHGVKVSSVEVD
LPAMLAQKDTAVKNLTRGVEGLFKKNKVNYVKGYGKFLSPSEVSVDTIDGENVVVKGKHI
IVATGSDVKSLPGITIDEKKIVSSTGALSLTEIPKKLIVIGAGYIGLEMGSVWGRLGSEV
TVVEFAADIVPAMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDSSGDGVKLIVEPAEGGEQ
TTLEADVVLVSAGRTPFTSGLDLEKIGVETDKGGRILVNERFSTNVSGVYAIGDVIPGPM
LAHKAEEDGVACVEFIAGKHGHVDYDKVPGVVYTYPEVASVGKTEEQLKKEGVSYNVGKF
PFMANSRAKAIDTAEGMVKILADKETDKILGVHIMSPNAGELIHEAVLAINYDASSEDIA
RVCHAHPTMSEAIKEAAMATYDKPIHM
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcgagcttagctaggagaaaagcgtactttctcaccagaaacatctctaat
tctcccactgatgctttcagattctctttctccctcactcgcggcttcgcttcgtcagga
tccgacgacaacgacgtcgtcatcatcggcggcggtcctggaggttatgtggcggcgatt
aaagcggcacagctcggtcttaagactacctgtatcgaaaagcgaggcgctctcggtggt
acttgtcttaacgtcggctgtattccttcaaaggcccttcttcactcttctcacatgtac
catgaagcaaagcacgtttttgctaaccatggtgttaaggtctcttcggttgaggtagat
cttcctgctatgttggcgcagaaagacacagccgtcaagaatttaacccgtggagtcgaa
ggtctgttcaagaagaacaaggtaaactatgttaagggctatggtaagtttctgtcccca
tcggaagtctctgtggacacaatcgatggagaaaacgtggttgtgaaaggcaaacatatc
atagttgcaactggctcggatgtcaagtctttgcctggaatcaccatcgatgaaaagaag
attgtctcatcaaccggggcactgtctctgacagagatcccaaagaaactcattgtcatt
ggtgctggctatattgggctagagatgggttctgtatggggacggctaggatcagaggtc
acagttgttgagtttgcagcggatatcgtaccagcaatggatggtgaaatccgcaagcag
tttcaacgctcactagagaagcagaagatgaaatttatgctcaaaactaaagtcgttggg
gtagattcatctggagatggtgttaaactcatagtggaacctgctgaaggtggagaacag
accactctagaagctgatgtggtcctcgtctcagctggtagaactccgttcacatctgga
cttgatctagagaaaatcggagttgagacagacaaaggcgggagaattctggtgaacgag
agattctcgacaaatgtttcaggcgtttatgcaattggagatgtgattccaggaccaatg
ctggctcacaaagccgaagaagatggtgttgcatgtgttgagtttatagcaggcaaacac
gggcatgtggattacgacaaagtccctggggttgtctacacgtaccctgaagttgcgtcg
gttggtaaaaccgaggagcagctgaagaaagaaggtgtaagctacaatgttggaaaattc
ccattcatggccaatagcagagccaaggccatagacacagcagagggaatggtcaagatt
ttggctgataaagagacagacaagatcttgggagttcacattatgtcaccaaacgcagga
gaattgatccatgaggcggttctagctatcaactatgatgcatcaagtgaagacattgct
cgagtctgtcacgctcatcccaccatgagtgaggctatcaaggaagctgccatggctacc
tatgacaagcccattcacatgtag

DBGET integrated database retrieval system