KEGG   Arabidopsis thaliana (thale cress): AT3G17609
Entry
AT3G17609         CDS       T00041                                 

Gene name
HYH
Definition
(RefSeq) HY5-homolog
  KO
K16241  transcription factor HY5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT3G17609 (HYH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT3G17609 (HYH)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   Plant G-box-binding factors
    AT3G17609 (HYH)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 CENP-F_leu_zip Phlebovirus_NSM Nnf1 DivIC bZIP_Maf Macoilin Cep57_CLD_2 DUF724
Other DBs
NCBI-GeneID: 821027
NCBI-ProteinID: NP_850605
MIPS: AT3G17609.1
TAIR: AT3G17609
UniProt: Q8W191 A0A178VIU6
Position
3
AA seq 149 aa
MSLQRPNGNSSSSSSHKKHKTEESDEELLMVPDMEAAGSTCVLSSSADDGVNNPELDQTQ
NGVSTAKRRRGRNPVDKEYRSLKRLLRNRVSAQQARERKKVYVSDLESRANELQNNNDQL
EEKISTLTNENTMLRKMLINTRPKTDDNH
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtctctccaacgacccaatgggaactcgagttcgtcttcttcccacaagaagcacaaa
actgaggaaagtgatgaggagttgttgatggttcctgacatggaagcagctggatcaaca
tgtgttctaagcagcagcgccgacgatggagtcaacaatccggagcttgaccagactcaa
aatggagtctctacagctaaacgccgccgtggaagaaaccctgttgataaagaatataga
agcctcaagagattattgaggaacagagtatcagcgcaacaagcaagagagaggaagaaa
gtgtatgtgagtgatttggaatcaagagctaatgagttacagaacaacaatgaccagctc
gaagagaagatttctactttgacgaacgagaacacaatgcttcgtaaaatgcttattaac
acaaggcctaaaactgatgacaatcactaa

DBGET integrated database retrieval system