KEGG   Arabidopsis thaliana (thale cress): AT3G17940Help
Entry
AT3G17940         CDS       T00041                                 

Definition
(RefSeq) Galactose mutarotase-like superfamily protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00052  Galactose metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT3G17940
   00052 Galactose metabolism
    AT3G17940
Enzymes [BR:ath01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AT3G17940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim Flg_new
Motif
Other DBs
NCBI-GeneID: 820642
NCBI-ProteinID: NP_566594
MIPS: AT3G17940.1
TAIR: AT3G17940
Araport: AT3G17940
UniProt: Q9LVH6 A0A178V9K8
Position
3
AA seq 341 aa AA seqDB search
MADQSKNTPEIFELNNGTMQVKISNYGTTITSLSVPDKNGKLGDVVLGFDSVDPYVKGLA
PYFGCIVGRVANRIKEGKFSLNGVNYTLPINKPPNSLHGGNKGFDKKIWEVAGHKRDGEK
PFITFKYHSADGEEGYPGAVSVTATYTLTSATTMRLDMEAVPENKDTPINLAQHTYWNLA
GHDSGNILDHKIQIWGSHITPVDEYTVPTGEILPVKGTPFDFTEEKRIGESIGEVGIGYD
HNYVLDCPDQEKEGLKHAAKLSDAASSRVLNLWTNVPGMQFYTGNYVNGVVGKGNAVYGK
HAGVCLETQGFPNAINQSNFPSVVVKAGEKYNHTMLFEFSA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcagagcaaaaacactccagagatcttcgagctcaacaatggcaccatgcag
gtcaagatctcaaactacggcaccaccatcacctctttgtctgttcccgacaagaacggg
aaactgggggatgtagttctcggattcgactcggtggatccatatgtgaaagggcttgca
ccatactttgggtgcattgttggtcgtgtggcaaatcggatcaaggagggaaaattcagt
ctcaatggagttaactacactttgcctatcaacaagcctcctaatagtctccacggtggt
aacaagggtttcgataagaagatatgggaagttgcagggcacaagagagacggcgaaaaa
cctttcatcactttcaaatatcacagtgccgatggagaagaaggttaccctggtgcggtt
tctgtcacggcgacatacactctcacgtcagccacgacaatgagacttgacatggaagct
gttccagagaacaaagatactcccatcaacttagctcaacatacatactggaacttagca
ggtcatgactcaggaaacattctagaccataagattcagatatgggggtctcatatcacg
ccggttgacgaatacacagttcctacaggagagatcttgcctgtaaagggaactcctttc
gatttcactgaggagaagcggataggcgagtctattggagaggttggtatcggatacgat
cataactacgtgttggactgtcctgatcaagagaaggaggggctgaaacacgcagcgaag
ctcagtgatgctgctagctcaagggtactgaacttgtggaccaatgtgccgggaatgcag
ttttataccgggaactatgtgaatggagtggttgggaaagggaatgcggtttacgggaaa
catgcgggtgtgtgccttgagacgcagggattcccgaacgcgattaaccagtcgaatttc
ccgtctgttgtggttaaggctggtgagaagtacaatcacacgatgctgtttgagttttca
gcttga

DBGET integrated database retrieval system