KEGG   Arabidopsis thaliana (thale cress): AT3G18070Help
Entry
AT3G18070         CDS       T00041                                 

Gene name
BGLU43
Definition
(RefSeq) beta glucosidase 43
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00460  Cyanoamino acid metabolism
ath00500  Starch and sucrose metabolism
ath00940  Phenylpropanoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT3G18070 (BGLU43)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AT3G18070 (BGLU43)
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT3G18070 (BGLU43)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AT3G18070 (BGLU43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 821332
NCBI-ProteinID: NP_188435
MIPS: AT3G18070.1
TAIR: AT3G18070
Araport: AT3G18070
UniProt: Q9LV34
Position
3
AA seq 501 aa AA seqDB search
MFLFLLLLSASRSGEESPSGDAVPLATGGLNRKSFPEGFLFGTATSAYQVEGETHQDGRG
PSIWDAFVKIPGKIANNATAEITVDQYHRYKEDVDLMQNLNIDAYRFSISWSRIFPEGSG
KINSNGVAYYNRLIDYLIEKGITPYANLYHYDLPLALEQKYQGLLSKQGRFCGLRRVLFQ
TFGDRVKNWMTFNEPRVVAALGYDNGIFAPGRCSEAFGNCTDGNSATEPYIVAHHLILAH
AAAVQRYRQNYQEKQKGRVGILLDFVWFEPLTSSQADNDAAQRARDFHVGWFIHPIVYGE
YPNTLQNIVKERLPKFTEEEVKMVKGSIDFVGINQYTTYFMSDPKISTTPKDLGYQQDWN
VTFNFAKNGTPIGPRAHSEWLYNVPWGMYKALMYIEERYGNPTMILSENGMDDPGNITLT
QGLNDTTRVKYYRDYLVQLKKAVDDGANLTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKD
LKRYPKMSALWFKQLLKRDQK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttttctcctcctcctctctgcttcccgctccggcgaagagtcgccgtccgga
gacgccgtcccattggccaccggcggtcttaacagaaagagttttccggaaggattcttg
ttcggaaccgccacgtcagcttaccaggtcgaaggcgagacccaccaagatggtcgtggt
ccaagcatttgggatgcattcgtcaagattcctggtaagattgccaacaatgccactgct
gagataacagtggaccaatatcatcgttacaaggaagatgtagatttgatgcagaacctg
aacattgatgcctacagattttccatttcatggtctagaatattccctgagggatccggt
aaaatcaactcgaatggagttgcttattacaatagattgatcgattacttgatcgaaaaa
gggattacaccgtatgctaatctgtaccactatgaccttcctttagccttggaacaaaag
tatcaaggcctgcttagtaaacaaggaagattttgcggattacgcagagttttgtttcaa
acatttggagatagagtgaagaactggatgacgtttaacgagcctcgtgtagtagctgct
ctaggttatgataacggcatttttgcgccgggtagatgctctgaagcatttggaaactgc
actgatggaaactctgcaactgaaccatacattgttgcacatcaccttatcttggcacat
gcagcagccgtccagagataccgccaaaattatcaggagaaacaaaagggaagggttggg
attctactggattttgtttggtttgagccacttacgagtagtcaagcagacaatgacgct
gctcaaagagcaagagacttccatgttggatggtttattcacccaatagtgtatggagag
tacccaaatacgttgcaaaacatcgtgaaggagagacttccgaagttcaccgaggaagaa
gtgaaaatggtgaaaggttccatagacttcgtggggataaaccaatacacaacttatttc
atgtctgatcctaaaatatctaccacacctaaagatttgggttatcaacaagattggaac
gtcacttttaactttgcaaagaatgggacaccaattggtccaagggcacattcagaatgg
ttatacaatgtcccatggggaatgtacaaagctttaatgtacattgaggaacgttatggc
aacccaactatgattctctccgaaaacggtatggatgatccgggcaacataactctaact
caaggactaaatgatacaacaagagtcaagtattatagagactatttagtgcagcttaaa
aaagcagtagacgatggagccaatctaactggatattttgcgtggtcgttgctagataat
ttcgaatggttatcaggatatacttcaaggtttggaatagtgtacgttgattacaaggac
ttgaagagataccccaagatgtctgctttatggtttaaacaacttttgaaacgggaccag
aaatga

DBGET integrated database retrieval system