KEGG   Arabidopsis thaliana (thale cress): AT3G18080Help
Entry
AT3G18080         CDS       T00041                                 

Gene name
BGLU44
Definition
(RefSeq) B-S glucosidase 44
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00460  Cyanoamino acid metabolism
ath00500  Starch and sucrose metabolism
ath00940  Phenylpropanoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT3G18080 (BGLU44)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AT3G18080 (BGLU44)
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT3G18080 (BGLU44)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AT3G18080 (BGLU44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 821333
NCBI-ProteinID: NP_188436
MIPS: AT3G18080.1
TAIR: AT3G18080
Araport: AT3G18080
UniProt: Q9LV33
Position
3
AA seq 512 aa AA seqDB search
MRHLSSPPWPLLLLLLLSSFTSGESSLSAEKNKLHTGGLSRQSFPKGFVFGTATSAYQVE
GETHQDGRGPSIWDAFVKIPGKIAKNATAEITVDQYHRYKEDVDLMKKLNFDAYRFSISW
SRIFPEGSGKVNWKGVAYYNRLIDYMVQKGITPYANLYHYDLPLALENKYKGLLGRQVVK
DFADYAEFCYKTFGDRVKNWMTFNEPRVVAALGYDNGIFAPGRCSKAFGNCTEGNSATEP
YIVTHHLILAHAAAVQRYRKYYQAKQKGRVGILLDFVWYEPLTRSKADNLAAQRARDFHI
GWFIHPLVYGEYPKTMQNIVKERLPKFTEKEVKMVKGSIDFVGINQYTTYYMSEPHPTTK
PKDLGYQQDWNVEFGFAKLGKPIGPRAYSSWLYNVPWGMYKALMYMKERYGNPTMILSEN
GMDDPGNVTLAQGLHDTTRIKYYKDYLTNLKKARDDGANVVGYFAWSLLDNFEWLSGYTS
RFGIVYVDYKTLKRYPKMSAQWFKQLLKRNNK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagacaccttagctcacctccatggcctctcctccttctcctcctcctctcttctttc
acctccggcgaatcctctctgtccgcagaaaaaaacaaattgcacaccggtggtctcagt
agacagagttttcctaaaggattcgtgtttggaaccgccacgtcagcttatcaagtcgaa
ggcgagactcatcaagacggtcgtggcccaagcatttgggatgccttcgtcaagattcct
gggaagatcgccaagaatgccacggctgagataacagtggaccagtatcaccgttacaag
gaagatgtggatttgatgaagaaactgaacttcgatgcttacagattttccatttcatgg
tccaggatattccctgagggaagtggtaaagtcaactggaaaggagttgcttattacaat
agattgattgattacatggttcaaaaagggattacaccttatgctaatctgtaccactac
gatcttccattggctttggaaaacaagtataaaggcttgcttggtagacaagtagtgaaa
gattttgcggattacgctgagttttgttacaagacatttggtgatagagtgaaaaattgg
atgacgttcaacgagccgcgtgtggtagctgctttaggttatgataatggtattttcgca
ccgggtagatgctcaaaagcatttggaaattgcactgaaggaaactccgcgacagagcca
tacatagttactcatcaccttatcttggcccacgcagcagcagtccaaagataccgcaaa
tattaccaagcgaaacaaaagggaagggttgggatacttttagatttcgtttggtatgag
ccgcttactagaagtaaagcagataatcttgcagctcaaagagcaagagacttccatatc
ggatggtttattcacccattagtatatggagagtatccaaagacaatgcagaacattgtg
aaagagaggcttccaaagttcacggagaaagaagtgaaaatggtgaaaggttccatagat
tttgtgggaataaaccaatacacgacttattacatgtccgaaccacatcccaccaccaaa
cctaaggatttgggttatcaacaagattggaatgtggaatttggctttgctaagttgggg
aagccaataggtccaagggcttactcgtcttggttatacaacgtaccatggggaatgtac
aaggccttgatgtatatgaaggaacgttacggcaaccctactatgatcctctctgaaaac
ggtatggatgacccgggaaacgttactctagctcaaggactacatgacaccacgagaatc
aagtattacaaagattacttaaccaaccttaagaaagctagggatgatggagccaatgtg
gttggatattttgcgtggtcattgctagataatttcgaatggttatcaggatatacttca
aggtttgggatcgtttatgttgattacaaaacattgaagaggtaccccaagatgtctgct
cagtggtttaagcaacttctgaaacgaaacaacaaatga

DBGET integrated database retrieval system