KEGG   Arabidopsis thaliana (thale cress): AT3G18660Help
Entry
AT3G18660         CDS       T00041                                 

Gene name
PGSIP1
Definition
(RefSeq) plant glycogenin-like starch initiation protein 1
  KO
K20890  xylan alpha-glucuronosyltransferase [EC:2.4.1.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ath01003]
    AT3G18660 (PGSIP1)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     AT3G18660 (PGSIP1)
Glycosyltransferases [BR:ath01003]
 Polysaccharide
  Structural polysaccharide
   AT3G18660 (PGSIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_8 Nucleotid_trans
Motif
Other DBs
NCBI-GeneID: 821397
NCBI-ProteinID: NP_001030722
MIPS: AT3G18660.1
TAIR: AT3G18660
Araport: AT3G18660
UniProt: Q9LSB1 W8Q6S4
Position
3
AA seq 659 aa AA seqDB search
MANSPAAPAPTTTTGGDSRRRLSASIEAICKRRFRRNSKGGGRSDMVKPFNIINFSTQDK
NSSCCCFTKFQIVKLLLFILLSATLFTIIYSPEAYHHSLSHSSSRWIWRRQDPRYFSDLD
INWDDVTKTLENIEEGRTIGVLNFDSNEIQRWREVSKSKDNGDEEKVVVLNLDYADKNVT
WDALYPEWIDEEQETEVPVCPNIPNIKVPTRRLDLIVVKLPCRKEGNWSRDVGRLHLQLA
AATVAASAKGFFRGHVFFVSRCFPIPNLFRCKDLVSRRGDVWLYKPNLDTLRDKLQLPVG
SCELSLPLGIQDRPSLGNPKREAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDD
NISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLL
ILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCTFQLLMEHINEIESYNGGDQGYLN
EVFTWWHRIPKHMNFLKHFWIGDEDDAKRKKTELFGAEPPVLYVLHYLGMKPWLCYRDYD
CNFNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCYLRSKQKAQLEYDRRQAEAANYADG
HWKIRVKDPRFKICIDKLCNWKSMLRHWGESNWTDYESFVPTPPAITVDRRSSLPGHNL
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcaaactctcccgctgctcctgcacccaccaccacaaccggtggtgactcccggcga
cgcctctccgcgtccatagaagcaatatgcaagaggagattccggagaaatagcaaagga
ggtggcagatcggatatggtgaaaccgtttaatatcataaatttttcgacacaagacaaa
aacagtagttgttgttgtttcaccaagtttcagatcgtgaagcttctcttgtttatcctt
ctctctgccactctcttcaccattatctattctcctgaagcttatcatcattctctttcc
cactcatcttctcgatggatatggagaagacaagatccacgttacttctcggatctggat
ataaactgggacgatgtgactaaaacccttgagaacatcgaagaaggccgtacgatcggt
gtcttgaattttgattcgaacgagatccaacgatggagagaagtatccaagagcaaggac
aatggggatgaagaaaaagttgttgtattgaatctagattacgcagacaagaatgtgact
tgggacgcactatatccagagtggatcgatgaggagcaagaaacagaggtccctgtttgt
cctaatatcccgaacattaaggtacctacaagaagactcgatctgatcgtcgtgaaactt
ccttgtcggaaagaagggaattggtcgagagacgtcgggagattgcatctacagctagcg
gctgcaactgtggcggcttcggccaaagggtttttcaggggacatgtgttttttgtatct
agatgctttccgattccgaatcttttccggtgtaaagatcttgtgtctcggagaggcgat
gtttggttgtacaaacctaatcttgataccttgagagacaagcttcagctgcctgtaggg
tcttgtgagctatctcttcctcttggcatccaagataggccaagcttaggaaaccctaaa
agagaagcttacgcaacaattcttcactcagctcacgtttacgtctgcggtgcaatcgcc
gcggctcagagcataagacagtctggttcgacgagagaccttgttatccttgttgatgac
aacatcagcggttaccaccggagtggactagaagccgcgggttggcaaatccggacgata
cagaggattcgaaaccctaaggcagagaaagatgcttacaacgaatggaactacagcaag
ttccggctatggcagctgactgattacgacaaaatcattttcatcgacgcggatctctta
atcttgagaaacatcgatttcttgttctcgatgcctgagatctcagctacaggaaacaat
ggaactctgtttaattcaggagttatggtgatcgagccttgcaactgtacgtttcagctt
ctgatggaacatataaacgagattgagtcttataacggtggagatcaaggttacttaaac
gaggtattcacatggtggcaccggattccaaaacatatgaatttcttgaagcatttttgg
attggcgatgaagatgacgcgaaacgcaagaaaacagagctttttggagcagagcctcct
gttctttatgttcttcattaccttgggatgaagccgtggttatgttaccgtgactacgac
tgtaacttcaactccgacatattcgttgagtttgctaccgatatcgctcatcgaaaatgg
tggatggtccacgacgccatgccacaggaacttcaccaattctgttacttgcgatccaag
caaaaggcacagctggaatatgatcgccggcaagcagaggccgcaaattatgccgacggt
cattggaaaataagagtaaaggacccgagattcaaaatttgcatcgacaaattatgtaat
tggaaaagtatgctgcggcattggggcgaatcaaattggactgactacgagtcttttgtt
cccaccccaccagccattaccgtagaccggagatcatcacttcccggccataacttgtga

DBGET integrated database retrieval system