KEGG   Arabidopsis thaliana (thale cress): AT3G19020
Entry
AT3G19020         CDS       T00041                                 
Name
(RefSeq) Leucine-rich repeat (LRR) family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: LRR_8 LRRNT_2
Other DBs
NCBI-GeneID: 821435
NCBI-ProteinID: NP_188532
TAIR: AT3G19020
UniProt: Q9LJ64 A0A178V723
Structure
Position
3:complement(6558964..6562377)
AA seq 956 aa
MTRRTMEKPFGCFLLLFCFTISIFFYSAAALTDEEASFLTRRQLLALSENGDLPDDIEYE
VDLDLKFANNRLKRAYIALQAWKKAFYSDPFNTAANWVGPDVCSYKGVFCAPALDDPSVL
VVAGIDLNHADIAGYLPPELGLLTDVALFHVNSNRFCGVIPKSLSKLTLMYEFDVSNNRF
VGPFPTVALSWPSLKFLDIRYNDFEGKLPPEIFDKDLDAIFLNNNRFESTIPETIGKSTA
SVVTFAHNKFSGCIPKTIGQMKNLNEIVFIGNNLSGCLPNEIGSLNNVTVFDASSNGFVG
SLPSTLSGLANVEQMDFSYNKFTGFVTDNICKLPKLSNFTFSYNFFNGEAQSCVPGSSQE
KQFDDTSNCLQNRPNQKSAKECLPVVSRPVDCSKDKCAGGGGGGSNPSPKPTPTPKAPEP
KKEINPPNLEEPSKPKPEESPKPQQPSPKPETPSHEPSNPKEPKPESPKQESPKTEQPKP
KPESPKQESPKQEAPKPEQPKPKPESPKQESSKQEPPKPEESPKPEPPKPEESPKPQPPK
QETPKPEESPKPQPPKQETPKPEESPKPQPPKQETPKPEESPKPQPPKQEQPPKTEAPKM
GSPPLESPVPNDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPV
FSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP
PPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHS
PPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMANAPTPS
SSESGEISTPVQAPTPDSEDIEAPSDSNHSPVFKSSPAPSPDSEPEVEAPVPSSEPEVEA
PKQSEATPSSSPPSSNPSPDVTAPPSEDNDDGDNFILPPNIGHQYASPPPPMFPGY
NT seq 2871 nt   +upstreamnt  +downstreamnt
atgacccgaagaacaatggagaagccttttggctgcttccttctcctcttttgtttcacc
atctccatttttttctattccgcagcggctctcaccgatgaggaagcttcttttcttaca
agacgccaacttttggcattatcagaaaacggagatcttcccgacgacatcgagtacgaa
gtcgatttagacctcaaatttgctaataacagacttaaaagggcttacattgcccttcaa
gcttggaaaaaggcattctactctgatccgttcaacactgcggctaattgggttggtcca
gacgtgtgttcttacaaaggagttttctgtgcaccagcacttgacgacccaagcgtattg
gttgtggcggggattgaccttaaccatgcggatatagccggatacttgccgcctgagcta
ggtttattgaccgatgtcgccttgtttcacgttaattccaacaggttttgcggagttatt
ccgaaaagtctttcgaagctaacgttaatgtatgaattcgacgtcagcaataaccgtttc
gttggtccgtttccgacagttgctctttcttggccgtctttgaaattccttgacataaga
tacaatgattttgaagggaaactaccaccagagatctttgataaagatctcgacgccatc
ttcttgaacaacaatagatttgagtcgaccatccccgagacaattggtaaatcaacagct
tccgttgtaaccttcgcacacaataaatttagcggttgcatcccaaaaaccattggccag
atgaagaacctcaacgagattgtgtttattgggaacaacctaagtggttgcttaccgaac
gaaatcggttcgttgaacaatgtgactgtgtttgatgctagcagcaatgggttcgtcgga
agtttgccatcgaccttgtcgggcttagccaacgtggaacaaatggatttctcgtacaat
aagttcaccggatttgtcacagacaatatctgcaagttgcccaaattgtcaaacttcaca
ttttcttacaatttcttcaatggagaagctcaaagttgtgtgcctggatcgagccaagag
aaacagtttgatgacacgagcaattgcttacagaacagaccaaaccagaagtcggctaaa
gaatgtttgccggtggttagccgtcctgtggattgcagtaaagacaagtgtgccggtgga
ggtggcggtggttcaaacccatcaccaaaaccaacaccaacaccaaaggcaccggagcct
aagaaagaaataaacccaccaaacttagaagagccatctaagccaaaaccagaagaatct
cccaaaccacaacagcctagtccaaagcctgagacaccatcacatgagccttctaaccca
aaggaacctaagccagagtcaccaaaacaggaatctccaaaaacggaacagccaaaacct
aagcctgagtcaccaaaacaagagtcgcctaagcaagaggcaccaaaaccagaacagcca
aaacctaagcctgagtcaccaaaacaagagtcgtctaagcaagagccaccaaaaccagaa
gaatctcctaaaccggaacctccaaaaccagaggagtcacctaagcctcaaccaccaaag
caagagacaccaaaaccagaggagtcacctaagcctcaaccaccaaagcaagagacacca
aaaccagaggagtcacctaagcctcaaccaccaaagcaagagaccccaaaaccagaggag
tcacctaagcctcaaccaccaaagcaagaacaaccaccaaagacagaggcaccaaaaatg
gggtcgcctccattggaatcaccggtaccaaatgatccttacgatgcatctccgattaaa
aaacgtcgtcctcaaccaccatcaccctcgacagaagagacaaagacaacgtcgccacaa
tctcctccagtacactctccaccaccaccaccaccggttcattccccaccgccgcctgta
ttttcacctcctcctccgatgcattctcctccaccaccggtttactcaccaccacctcca
gtacactctcctccaccaccaccagtccactctcctccaccaccagtacattcaccacca
ccaccagtccattctcctcctccaccggtccattcaccaccaccaccagtccactctcct
cctccaccagtccactctcctcctccaccggtccagtcacctccaccaccaccagttttc
tctccaccaccgcctgcaccaatctactcacctcctcctccaccagtccactccccgcct
ccaccggtccactctccaccaccgccaccagtccactcaccacctcctcctgttcactca
ccgcctcctccagttcactccccgccgcctccagtccattctccaccaccaccagtccac
tctccaccacctccgtcacctatctactctcctcctcctccagttttctcaccgccaccg
aaacctgtaacgcctctaccaccagcaacatcgccaatggcaaacgctccaacaccttca
tcatcagaatcaggagaaatctcaacaccggttcaagctccgaccccagactctgaggac
atcgaagcaccatcagattcaaatcattcaccagtgttcaaatcaagtccagctccatca
ccagattccgagccagaagttgaagcaccagtaccatcaagcgaaccagaagttgaagca
ccaaaacaatcagaagccaccccttcgtcatcaccgccatcttcaaatccatcaccagat
gtaactgcaccaccatcggaagacaacgacgacggcgataatttcatcctcccaccaaac
attggacaccaatatgcatcgccaccaccaccgatgttcccaggctactga

DBGET integrated database retrieval system