KEGG   Arabidopsis thaliana (thale cress): AT3G19170
Entry
AT3G19170         CDS       T00041                                 
Symbol
PREP1
Name
(RefSeq) presequence protease 1
  KO
K06972  presequence protease [EC:3.4.24.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ath01002]
    AT3G19170 (PREP1)
Peptidases and inhibitors [BR:ath01002]
 Metallo peptidases
  Family M16: pitrilysin family
   AT3G19170 (PREP1)
SSDB
Motif
Pfam: M16C_assoc Peptidase_M16_C Peptidase_M16
Other DBs
NCBI-GeneID: 821451
NCBI-ProteinID: NP_188548
TAIR: AT3G19170
UniProt: Q9LJL3 A0A178VHU1
Structure
Position
3:complement(6625377..6632164)
AA seq 1080 aa
MLRTVSCLASRSSSSLFFRFFRQFPRSYMSLTSSTAALRVPSRNLRRISSPSVAGRRLLL
RRGLRIPSAAVRSVNGQFSRLSVRAVATQPAPLYPDVGQDEAEKLGFEKVSEEFISECKS
KAILFKHKKTGCEVMSVSNEDENKVFGVVFRTPPKDSTGIPHILEHSVLCGSRKYPVKEP
FVELLKGSLHTFLNAFTYPDRTCYPVASTNTKDFYNLVDVYLDAVFFPKCVDDAHTFQQE
GWHYELNDPSEDISYKGVVFNEMKGVYSQPDNILGRIAQQALSPENTYGVDSGGDPKDIP
NLTFEEFKEFHRQYYHPSNARIWFYGDDDPVHRLRVLSEYLDMFEASPSPNSSKIKFQKL
FSEPVRLVEKYPAGRDGDLKKKHMLCVNWLLSEKPLDLQTQLALGFLDHLMLGTPASPLR
KILLESGLGEALVSSGLSDELLQPQFGIGLKGVSEENVQKVEELIMDTLKKLAEEGFDND
AVEASMNTIEFSLRENNTGSFPRGLSLMLQSISKWIYDMDPFEPLKYTEPLKALKTRIAE
EGSKAVFSPLIEKLILNNSHRVTIEMQPDPEKATQEEVEEKNILEKVKAAMTEEDLAELA
RATEELKLKQETPDPPEALRCVPSLNLGDIPKEPTYVPTEVGDINGVKVLRHDLFTNDII
YTEVVFDIGSLKHELLPLVPLFCQSLLEMGTKDLTFVQLNQLIGRKTGGISVYPLTSSVR
GKDEPCSKIIVRGKSMAGRADDLFNLMNCLLQEVQFTDQQRFKQFVSQSRARMENRLRGS
GHGIAAARMDAMLNIAGWMSEQMGGLSYLEFLHTLEKKVDEDWEGISSSLEEIRRSLLAR
NGCIVNMTADGKSLTNVEKSVAKFLDLLPENPSGGLVTWDGRLPLRNEAIVIPTQVNYVG
KAGNIYSTGYELDGSAYVISKHISNTWLWDRVRVSGGAYGGFCDFDSHSGVFSYLSYRDP
NLLKTLDIYDGTGDFLRGLDVDQETLTKAIIGTIGDVDSYQLPDAKGYSSLLRHLLGVTD
EERQRKREEILTTSLKDFKDFAQAIDVVRDKGVAVAVASAEDIDAANNERSNFFEVKKAL
NT seq 3243 nt   +upstreamnt  +downstreamnt
atgctccgaaccgtctcttgtttagcttcgcgcagctcgtcctctctattctttcgcttc
tttcgtcagttccctcgctcttacatgtctctcacatcgtcgacggcagctctccgtgtc
cccagtcgcaatcttcgccgaatttcctctccctcagtcgccggtagacgtcttttgctc
cgacgaggtttgaggattccctccgccgcagttcgcagtgtcaatgggcagttctctcgc
ctctctgttcgcgccgtcgccacacaacccgctccactttatcctgatgtaggtcaagat
gaggctgagaagcttggatttgaaaaagtgtcggaagaattcatctcagagtgtaaatca
aaggcgatactcttcaaacacaagaaaactggttgcgaggtgatgtctgtgtcaaatgag
gatgagaacaaggtcttcggtgttgttttcagaactcctccgaaggattccactggcatt
ccgcacatactggaacatagcgttctatgtgggtcaagaaagtacccggtaaaagagcca
tttgttgaactactcaagggaagtttgcatacttttctaaatgcattcacatatcctgat
aggacctgctacccagttgcttccaccaatacaaaggatttttacaatcttgtcgatgta
tatttggatgctgtcttcttccccaagtgtgtggatgacgctcacacctttcagcaagag
ggctggcactatgaacttaatgatccctcggaagacatatcttacaaaggtgttgttttt
aatgagatgaaaggggtctattcacagcctgataatattttagggcgaattgctcaacag
gccttatccccagaaaatacatatggtgttgacagtggaggtgatccaaaagatattcct
aatctgacatttgaggaattcaaggagttccaccgtcaatattatcacccaagcaacgcc
aggatctggttctatggagatgatgatcccgttcaccgcctccgtgtcttgagtgaatac
ttggatatgtttgaagcaagtccatctcccaatagttcaaagattaaatttcaaaagcta
ttctctgagcctgtcagactggttgagaaatatcctgctggtcgagatggtgaccttaaa
aagaagcatatgttgtgcgttaactggctattgtctgagaagcccttggacttgcaaact
caacttgcacttggcttcttggatcatcttatgctggggactcctgcttcaccactaaga
aagatcttattggaaagcggtttaggagaagctcttgtcagtagtgggttgtcagacgaa
ctcttgcagccccagttcggtattggtttgaaaggtgtgtccgaagagaatgttcaaaag
gttgaagagttgatcatggatactctgaaaaagttggcagaagaagggtttgacaatgat
gctgtggaggcatccatgaatacaattgagttttctttgagggaaaacaacacaggatct
ttccctcgtggtttatcacttatgctccaatctatttcaaaatggatatacgatatggat
ccttttgagccattaaagtatacggaaccattgaaggccctgaaaaccagaatagctgag
gagggatccaaggctgtcttttccccactgatagagaagcttatcttgaacaactcgcat
cgtgttaccatagagatgcagcctgatcctgaaaaagctactcaagaggaagtggaagag
aaaaatatcctggaaaaagttaaagcagctatgacagaagaagatcttgcagagctagca
cgtgctacagaggagctgaaattgaaacaagaaactcctgaccctcctgaagcattgaga
tgtgtcccaagtttgaacttgggtgacattccaaaagaacctacttatgttcccaccgag
gttggagatattaatggtgtgaaggttttgcggcatgaccttttcaccaatgatattatc
tatactgaagtagtctttgatattggttcgctgaaacatgagcttcttccactagtacca
cttttctgtcaatcattactggagatgggcacaaaagatttgacttttgttcaacttaat
cagttgattggaaggaaaacgggagggatatcagtttatccccttacatcatcagtgagg
ggtaaggatgaaccatgcagcaaaattatcgtacgcggaaaatccatggctgggcgtgct
gacgacctttttaacctgatgaactgcttgttgcaagaggttcaatttacagatcagcag
aggtttaaacagtttgtctctcaaagcagagcacggatggagaaccgattgaggggaagt
ggtcatggaattgctgcggcgaggatggatgcaatgttgaacattgctggatggatgtct
gaacagatgggtggtctcagctatcttgaatttttacatactcttgaaaagaaagtggat
gaagactgggaaggaatttcatcctcgcttgaggagatcagaagatctctccttgctaga
aacggttgcatagttaatatgactgctgatgggaagtctctcacaaatgtcgaaaaatct
gttgcaaaatttctagatttactccctgagaacccgtctggtgggcttgtcacttgggat
ggtcgacttcctctgagaaatgaagccattgtaataccaacccaggtaaactatgttgga
aaagcgggtaacatatacagcaccgggtatgagcttgatggcagtgcgtatgttatatca
aagcatattagcaatacatggttatgggatcgtgttcgtgtaagtggtggtgcatatgga
ggtttctgtgatttcgattcgcattcaggagtattttcttacttatcgtaccgggatcca
aacttgttgaagacacttgatatatatgatggaactggagatttcttacgtggccttgat
gtggatcaagaaacactcactaaagctattattggcaccatcggtgatgttgattcatac
caattacctgatgccaaaggttatagcagtttgttgaggcatttactcggagtaactgac
gaagaacgacaaagaaagcgtgaagagatactaacaacaagtttgaaggacttcaaggat
ttcgcacaagcaatagatgtggttagagataaaggtgttgcggtggctgtggcatccgcg
gaagacattgatgcagcgaacaatgaacgctccaactttttcgaggtgaagaaagctctc
taa

DBGET integrated database retrieval system