KEGG   Arabidopsis thaliana (thale cress): AT3G19950
Entry
AT3G19950         CDS       T00041                                 
Name
(RefSeq) RING/U-box superfamily protein
  KO
K11982  E3 ubiquitin-protein ligase RNF115/126 [EC:2.3.2.27]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G19950
   04121 Ubiquitin system [BR:ath04121]
    AT3G19950
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     AT3G19950
Membrane trafficking [BR:ath04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    AT3G19950
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    AT3G19950
SSDB
Motif
Pfam: zf-RING_2 zinc_ribbon_9 zf-C3HC4_2 zf-RING_11 zf-rbx1 zf-C3HC4 zf-C3HC4_3 zf-RING_UBOX zf-RING_5 zf-ANAPC11 zf-RING_16 Prok-RING_1 zf-RING_4 zf-RING_10 zf-HC5HC2H zf-Nse
Other DBs
NCBI-GeneID: 821533
NCBI-ProteinID: NP_188629
TAIR: AT3G19950
UniProt: Q8LPN7 A0A178VDZ4
Position
3:6942623..6945224
AA seq 328 aa
MSSGVNSTGSAAAAPEVDKMFFCYQCNQTVTISISSSADPFCPICNQGFLEEYEDPNPNQ
SLNFNPNSSDSFFPMADPFSTLLPLIFGSSAAAPSGMDFMSLFGPSMQPQARSTQQNPQS
DAFDPFTFLQNHLQTLRSSGTHFEFVIENHPSDPGNRMPGNFGDYFFGPGLEQLIQQLAE
NDPNRYGTPPASKSAIDALPTVKVTKDMLKSEMNQCAVCMDEFEDGSDVKQMPCKHVFHQ
DCLLPWLELHNSCPVCRFELPTDDPDYENRSQGSQGSGDGQGSVEGQQTPRFSIQLPWPF
RRQDGSGSGSGAPGTGGGNLETRGEDLD
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtcttccggcgtaaattcaactggctccgccgcagcagcaccggaggttgacaagatg
ttcttctgctaccagtgcaatcaaacagtcacaatctcaatttcctcatccgctgatcct
ttttgtccaatttgtaaccaagggtttcttgaagaatacgaagaccctaaccctaatcaa
tccctcaatttcaaccctaactcttctgattcctttttccccatggccgatcctttctcc
accttgctcccgctcatattcggctcttccgctgccgctccttccggcatggacttcatg
agcttattcggtccttcgatgcaaccacaggctcgttccactcagcagaatcctcagtct
gacgcgtttgatccgtttacgtttcttcagaatcatctccagactttgcgatctagcggt
acgcactttgagttcgtgatcgagaatcatccttcggatccaggtaatcgtatgcctggg
aatttcggtgattacttctttggtccaggtcttgagcagttgattcagcaactagctgag
aatgatcctaatcgttacggaactcctcctgcttccaaatccgccattgatgctcttcct
actgttaaggtaacgaaggatatgttgaaatcggagatgaaccaatgcgcggtgtgtatg
gatgagtttgaggatggtagcgatgttaagcagatgccttgtaagcacgtctttcatcag
gactgtttgctcccttggctggagttgcataattcgtgtcctgtttgtcgattcgagttg
cctacggatgatcctgattatgagaacaggagtcaaggaagtcaggggagtggtgatgga
caaggatcggttgagggtcagcagacgccgaggtttagtatacaacttccttggccgttc
aggagacaagatggctctggttcaggctcgggagcacctggtactggtggaggtaatctt
gagaccaggggtgaagatttggattga

DBGET integrated database retrieval system