KEGG   Arabidopsis thaliana (thale cress): AT3G20460Help
Entry
AT3G20460         CDS       T00041                                 

Definition
(RefSeq) Major facilitator superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 Pox_A14
Motif
Other DBs
NCBI-GeneID: 821591
NCBI-ProteinID: NP_188681
MIPS: AT3G20460.1
TAIR: AT3G20460
Araport: AT3G20460
UniProt: Q9LTP6
Position
3
AA seq 488 aa AA seqDB search
MGDEPLLQKVKIQEDIESVPLLQKVKIQEDIESVKGIRVNNDGEEDGPVTLILLFTTFTA
LCGTFSYGTAAGFTSPAQTGIMAGLNLSLAEFSFFGAVLTIGGLVGAAMSGKLADVFGRR
GALGVSNSFCMAGWLMIAFSQATWSLDIGRLFLGVAAGVASYVVPVYIVEIAPKKVRGTF
SAINSLVMCASVAVTYLLGSVISWQKLALISTVPCVFEFVGLFFIPESPRWLSRNGRVKE
SEVSLQRLRGNNTDITKEAAEIKKYMDNLQEFKEDGFFDLFNPRYSRVVTVGIGLLVLQQ
LGGLSGYTFYLSSIFKKSGFPNNVGVMMASVVQSVTSVLGIVIVDKYGRRSLLTVATIMM
CLGSLITGLSFLFQSYGLLEHYTPISTFMGVLVFLTSITIGIGGIPWVMISEMTPINIKG
SAGTLCNLTSWSSNWFVSYTFNFLFQWSSSGVFFIYTMISGVGILFVMKMVPETRGRSLE
EIQAAITR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgaaccacttcttcagaaagtcaagattcaagaagacattgaatccgtacca
cttcttcagaaagtcaagattcaagaagacattgaatccgttaaaggaattcgtgtaaat
aatgacggcgaagaggacggtcccgttactttaattctactcttcacaaccttcactgct
ctctgcggcaccttctcctatggcactgccgccggctttacatcaccagctcaaaccggg
attatggcaggactgaacctttctttggctgagttctcattctttggggctgtcttaaca
attggtggacttgtgggagccgcgatgtcgggaaaacttgctgatgtctttggtcgaaga
ggcgctttgggggtttcaaactcgttttgcatggccggctggcttatgattgccttctct
caggcgacttggtcccttgatatcggaagactttttctcggggtcgcagctggcgtagct
tcttatgtggtaccagtctatattgttgaaatcgctcccaaaaaagttcgtggcacattc
tctgcgattaactcgcttgtgatgtgtgctagcgtcgccgtcacatacctccttggatca
gtcatttcatggcaaaaattagctctcataagtacggttccttgtgtttttgaattcgtc
ggtttattcttcataccggagtctcctaggtggctgtctagaaacggtagggtgaaagaa
tcggaagtttcactccaacgcctacgaggaaacaacactgatatcactaaagaggctgca
gaaatcaaaaaatatatggataatcttcaagaattcaaagaagatggttttttcgatctc
ttcaacccacgatattctcgtgtcgttactgttggaattggattgctagtactacaacaa
ctgggaggtctcagtggctatacattttaccttagctcgatattcaaaaaatcggggttt
cctaacaacgtaggagtaatgatggcgagcgtggtgcagtctgtgacaagcgttttagga
atagtaatcgtggataaatatggaagacgatcccttttaacggttgcgacgatcatgatg
tgtttgggctcattaattacaggactatcgtttttgtttcagagctatggtttacttgaa
cattacaccccaatttcaacatttatgggagtgttggtttttctaacttcgattacaatc
ggaataggaggtattccatgggttatgatatctgagatgacaccgatcaatataaaagga
tcagcagggacgctatgcaatttaactagctggtccagcaattggttcgtctcttacaca
ttcaacttcctcttccagtggagctcttctggtgtgtttttcatatatacaatgatatcg
ggtgtgggcatcctgtttgtgatgaagatggtacccgagactcgaggtcgttcgctcgaa
gaaattcaagctgccattacccgataa

DBGET integrated database retrieval system