KEGG   Arabidopsis thaliana (thale cress): AT3G20800
Entry
AT3G20800         CDS       T00041                                 

Definition
(RefSeq) Cell differentiation, Rcd1-like protein
  KO
K12606  CCR4-NOT transcription complex subunit 9
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AT3G20800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ath03019]
    AT3G20800
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     AT3G20800
SSDB
Motif
Pfam: Rcd1
Other DBs
NCBI-GeneID: 821628
NCBI-ProteinID: NP_188716
MIPS: AT3G20800.1
TAIR: AT3G20800
UniProt: Q8RWV5 A0A384KHS9
Position
3
AA seq 316 aa
MANLPSSLSMGTPFGGPSTSAQNPTGAPANKDRNLASAEQLVLDLSNPELRENALLELSK
KRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAPPNLTPAQSNRVCNSLALLQCVASHS
DTRMLFLKAHIPLYLYPFLNTTSKSRPFEYLRLTSLGVIGALVKVDDTEVISFLLSTEII
PLCLRTMEMGSELSKTVATFIVQKILLDDVGMDYICTTAERFFAVGRVLGNMVQSLVEQP
SPRLLKHIIRCYLRLSDNPRACAALASCLPDSLRDGSFSNCLREDPTARRWLQQLVHNVG
VGRVPTHQGGGFEHML
NT seq 951 nt   +upstreamnt  +downstreamnt
atggcgaatctaccttcttctctctccatgggcacacctttcggtggtcctagcacctcc
gcacaaaatcctaccggagctccggccaacaaagatcgcaatttggcctctgctgaacag
ttggtactcgatctcagcaatcctgaactcagagaaaatgctcttctcgagctttccaag
aaaagagaattgtttcaggatctggcgcctttgttgtggaactcttttggtaccattgct
gccttgttacaggagattgtatcaatctactctgttcttgcacctccaaatctgactcct
gctcagtccaaccgtgtttgcaactcgctcgctcttcttcagtgcgtagcatctcattct
gacacgagaatgttatttctcaaggctcatatcccgttgtacctttatcccttccttaat
acaacgagtaagtccagacctttcgaatacttgcggcttactagcctaggtgtcatcggt
gcacttgtgaaggttgatgatacagaggtcattagcttccttctttcaactgaaattatt
cctctgtgcctccgtaccatggaaatggggagtgagctgtcaaaaacagtggcaacattt
attgttcaaaagatactgttggatgatgtggggatggattacatctgcacaacagcagag
cggttttttgcagttggtcgagtgttgggaaatatggttcagtcacttgtggagcagcct
tctccgcgccttttgaagcatatcattcgttgctatctccgtttatcagacaacccaagg
gcttgtgctgcactcgcaagctgtctccctgactcgctacgagatggatcctttagcaat
tgtcttcgcgaggatccaactgcaagaaggtggctgcaacagttggtgcacaatgttgga
gttggtcgcgtcccaacacatcaaggtggaggatttgagcacatgctttga

DBGET integrated database retrieval system