KEGG   Arabidopsis thaliana (thale cress): AT3G21110Help
Entry
AT3G21110         CDS       T00041                                 

Gene name
PUR7
Definition
(RefSeq) purin 7
  KO
K01923  phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00230  Purine metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AT3G21110 (PUR7)
Enzymes [BR:ath01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     AT3G21110 (PUR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAICAR_synt hnRNP_Q_AcD
Motif
Other DBs
NCBI-GeneID: 821663
NCBI-ProteinID: NP_001030739
MIPS: AT3G21110.1
TAIR: AT3G21110
Araport: AT3G21110
UniProt: P38025
Position
3
AA seq 411 aa AA seqDB search
MAQCVRSTLNPVRTPQSFTRKAYVKSPAFASVSFLRAVPEFNKYPKPCSLVMSCQGKAQN
QQEERPQLSLDDLVTSNRKGEVLGTIKDSLSNCLSETNLLATVPGLKSRIKGKVRDIYDA
GDYLVLITTDRLSAFDRNLASIPFKGQVLNETSLWWFNNTQHITPNAIVSSPDRNVVIAK
KCSVFPIEFVVRGYVTGSTDTSLWTVYNKGVRNYCGNELSDGLVKNQKLPANILTPTTKA
ADHDVPISPNEIVEGGFMTQAEFDEASMKALSLFEFGQGVAKKHGLILVDTKYEFGRSSD
GSILLIDEIHTPDSSRYWLAGSYEERFQKGLEPENVDKEFLRLWFKENCNPYEDEVLPAA
PAELVTELAWRYIFLYETITGSRIDIIPTQEPIHDRISRNTSQALSSLRQL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtgtgtgaggtcaactctaaatcctgtgagaacaccccagagctttactagg
aaagcgtatgtgaaaagcccagcttttgcatcagtctcgttccttcgagcagtaccggag
ttcaacaaatacccaaaaccttgttcattggttatgtcttgccagggcaaggctcaaaac
cagcaggaggagcgaccacaactgtctcttgacgatttagtcacgagtaaccggaaaggg
gaggttcttggcacaatcaaagactcgctttctaattgtctctctgagactaatcttctt
gccactgttcctggtctgaaatctagaatcaagggaaaggtcagagatatttatgatgct
ggtgattatctggttcttattacaactgatcggttgagtgcattcgacagaaaccttgct
tcaattcccttcaaaggccaggttcttaatgagacaagtttgtggtggttcaataacaca
cagcacataactccaaatgcaatcgtttcatctcctgatagaaatgttgttatcgcaaag
aaatgctcggtttttcccatagagtttgtggttagaggatatgtgactggaagtactgac
acatctttatggacggtgtacaataaaggtgttcggaactactgtgggaatgagctctca
gatggattagttaaaaaccagaagcttccagctaatatacttacaccaacaactaaggct
gcggatcatgatgtgcccatctctccaaatgagatagttgaaggtggattcatgactcaa
gctgaatttgatgaagcaagtatgaaagctttgagcttgtttgagtttgggcagggggtg
gccaagaaacatggactgatattggtggacacaaagtatgagtttggaagaagtagtgat
ggctcaatcttattgattgatgagattcatacacccgattccagcagatactggcttgcg
ggttcatatgaagagcgcttccaaaaaggcctggagcctgaaaatgttgataaggagttc
ctaagattgtggttcaaagagaactgcaatccgtatgaggacgaggtcctgcctgctgct
ccagcagaactcgtgactgaattagcttggcggtacattttcttgtatgaaactatcact
ggatcaagaattgacattattccgactcaggaaccaatacatgaccgaatctcaaggaac
acaagccaagcactttcatctctccgtcaactttga

DBGET integrated database retrieval system